eF-site ID 1qol-A PDB Code 1qol Chain A click to enlarge Title STRUCTURE OF THE FMDV LEADER PROTEASE Classification HYDROLASE Compound PROTEASE (NONSTRUCTURAL PROTEIN P20A) Source (POLG_FMDVO) Sequence A:  MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFF DWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIK HLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEH AVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAK VQRKLK Description (1)  PROTEASE (NONSTRUCTURAL PROTEIN P20A) Functional site 1) chain A residue 135 type sequence A description BINDING SITE FOR RESIDUE CL Z 1 source : AC1 2) chain A residue 76 type sequence E description BINDING SITE FOR RESIDUE EDO A 301 source : AC4 3) chain A residue 77 type sequence N description BINDING SITE FOR RESIDUE EDO A 301 source : AC4 4) chain A residue 81 type sequence E description BINDING SITE FOR RESIDUE EDO A 301 source : AC4 5) chain A residue 51 type catalytic sequence A description 746 source MCSA : MCSA1 6) chain A residue 46 type catalytic sequence N description 746 source MCSA : MCSA1 7) chain A residue 148 type catalytic sequence H description 746 source MCSA : MCSA1 8) chain A residue 163 type catalytic sequence D description 746 source MCSA : MCSA1 9) chain A residue 51 type ACT_SITE sequence A description For leader protease activity source Swiss-Prot : SWS_FT_FI1 10) chain A residue 148 type ACT_SITE sequence H description For leader protease activity source Swiss-Prot : SWS_FT_FI1 11) chain A residue 163 type ACT_SITE sequence D description For leader protease activity source Swiss-Prot : SWS_FT_FI1 12) chain A residue 201 type SITE sequence K description Cleavage; by leader protease => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links