eF-site ID 1qly_2-A
PDB Code 1qly
Model 2
Chain A

click to enlarge
Title NMR Study of the SH3 Domain From Bruton's Tyrosine Kinase, 20 Structures
Classification TYROSINE-PROTEIN KINASE
Compound TYROSINE-PROTEIN KINASE BTK
Source Homo sapiens (Human) (BTK_HUMAN)
Sequence A:  LKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRAR
DKNGQEGYIPSNYVTEAE
Description (1)  TYROSINE-PROTEIN KINASE BTK (E.C.2.7.1.112)

Display surface

Download
Links