eF-site ID 1qls-A PDB Code 1qls Chain A click to enlarge Title S100C (S100A11),OR CALGIZZARIN, IN COMPLEX WITH ANNEXIN I N-TERMINUS Classification METAL-BINDING PROTEIN/INHIBITOR Compound S100C PROTEIN Source (ANX1_HUMAN) Sequence A:  PTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTE LAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLNLIGG LAIACHDSFIKSTQK Description Functional site 1) chain A residue 23 type sequence A description BINDING SITE FOR RESIDUE CA A 101 source : AC1 2) chain A residue 26 type sequence D description BINDING SITE FOR RESIDUE CA A 101 source : AC1 3) chain A residue 28 type sequence N description BINDING SITE FOR RESIDUE CA A 101 source : AC1 4) chain A residue 31 type sequence K description BINDING SITE FOR RESIDUE CA A 101 source : AC1 5) chain A residue 36 type sequence E description BINDING SITE FOR RESIDUE CA A 101 source : AC1 6) chain A residue 66 type sequence D description BINDING SITE FOR RESIDUE CA A 102 source : AC2 7) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE CA A 102 source : AC2 8) chain A residue 70 type sequence D description BINDING SITE FOR RESIDUE CA A 102 source : AC2 9) chain A residue 72 type sequence Q description BINDING SITE FOR RESIDUE CA A 102 source : AC2 10) chain A residue 77 type sequence E description BINDING SITE FOR RESIDUE CA A 102 source : AC2 11) chain A residue 66-78 type prosite sequence DLDSDGQLDFQEF description EF_HAND_1 EF-hand calcium-binding domain. DLDSDGQLDfqEF source prosite : PS00018 12) chain A residue 61-82 type prosite sequence MMKKLDLDSDGQLDFQEFLNLI description S100_CABP S-100/ICaBP type calcium binding protein signature. MMkkLDldsDgqlDFqEFlnLI source prosite : PS00303 13) chain A residue 31 type MOD_RES sequence K description N-acetylalanine => ECO:0000269|PubMed:3303336 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 36 type MOD_RES sequence E description N-acetylalanine => ECO:0000269|PubMed:3303336 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 68 type MOD_RES sequence D description Phosphoserine; by TRPM7 => ECO:0000269|PubMed:15485879 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 70 type MOD_RES sequence D description Phosphoserine; by TRPM7 => ECO:0000269|PubMed:15485879 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 72 type MOD_RES sequence Q description Phosphoserine; by TRPM7 => ECO:0000269|PubMed:15485879 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 77 type MOD_RES sequence E description Phosphoserine; by TRPM7 => ECO:0000269|PubMed:15485879 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 8 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P31949 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links