eF-site ID 1qk6_3-A
PDB Code 1qk6
Model 3
Chain A

click to enlarge
Title Solution structure of huwentoxin-I by NMR
Classification TOXIN
Compound HUWENTOXIN-I
Source ORGANISM_COMMON: CHINESE BIRD SPIDER; ORGANISM_SCIENTIFIC: SELENOCOSMIA HUWENA;
Sequence A:  ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL
Description (1)  HUWENTOXIN-I


Functional site

1) chain A
residue 2-29
type prosite
ligand
sequence CKGVFDACTPGKNECCPNRVCSDKHKWC
description Huwentoxin-1 family signature. C-[KALRVG]-x-{M}-x(1,3)-C-x(4,6)-C-C-x(4,6)-C-x(4)-[ERK]-W-C
source prosite : PS60021


Display surface

Download
Links