eF-site ID 1qjb-A PDB Code 1qjb Chain A click to enlarge Title 14-3-3 ZETA/PHOSPHOPEPTIDE COMPLEX (MODE 1) Classification KINASE INHIBITOR/PEPTIDE Compound 14-3-3 PROTEIN ZETA/DELTA Source (1QJB) Sequence A:  MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEE RNLLSVAYKNVVGARRSSWRVVSSIEQKEKKQQMAREYRE KIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGD YYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTH PIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELD TLSEESYKDSTLIMQLLRDNLTLWTSDT Description (1)  14-3-3 PROTEIN ZETA/DELTA, PHOSPHOPEPTIDE Functional site 1) chain A residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI7 2) chain A residue 232 type MOD_RES sequence T description Phosphothreonine; by CK1 => ECO:0000269|PubMed:31024343, ECO:0000269|PubMed:9360956, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI8 3) chain A residue 56 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000250|UniProtKB:P63103 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 127 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000250|UniProtKB:P63103 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|Ref.8, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 8) chain A residue 58 type MOD_RES sequence S description Phosphoserine; by PKA and PKB/AKT1 => ECO:0000269|PubMed:11956222, ECO:0000269|PubMed:12865427, ECO:0000269|PubMed:15883165, ECO:0000269|PubMed:16376338 source Swiss-Prot : SWS_FT_FI4 9) chain A residue 184 type MOD_RES sequence S description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:15071501, ECO:0000269|PubMed:15696159 source Swiss-Prot : SWS_FT_FI5 10) chain A residue 207 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI6 11) chain A residue 41-51 type prosite sequence RNLLSVAYKNV description 1433_1 14-3-3 proteins signature 1. RNLLSVAYKNV source prosite : PS00796 12) chain A residue 211-230 type prosite sequence YKDSTLIMQLLRDNLTLWTS description 1433_2 14-3-3 proteins signature 2. YKDSTLIMQLLRDNLTLWTS source prosite : PS00797

Display surface Download Links