eF-site ID 1qi7-A
PDB Code 1qi7
Chain A

click to enlarge
Title THE CRYSTAL STRUCTURE AT 2.0 A OF SAPORIN SO6, A RIBOSOME INACTIVATING PROTEIN FROM SAPONARIA OFFICINALIS
Classification HYDROLASE
Compound PROTEIN (N-GLYCOSIDASE)
Source ORGANISM_COMMON: common soapwort; ORGANISM_SCIENTIFIC: Saponaria officinalis;
Sequence A:  VTSITLDLVNPTAGQYSSFVDKIRNNVKDPNLKYGGTDIA
VIGPPSKEKFLRINFQSSRGTVSLGLKRDNLYVVAYLAMD
NTNVNRAYYFKSEITSAELTALFPEATTANQKALEYTEDY
QSIEKNAQITQGDKSRKELGLGIDLLLTFMEAVNKKARVV
KNEARFLLIAIQMTAEVARFRYIQNLVTKNFPNKFDSDNK
VIQFEVSWRKISTAIYGDAKNGVFNKDYDFGFGKVRQVKD
LQMGLLMYLGKPK
Description (1)  N-GLYCOSIDASE


Functional site

1) chain A
residue 89
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 301
source : AC1

2) chain A
residue 91
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 301
source : AC1

3) chain A
residue 95
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 A 301
source : AC1

4) chain A
residue 96
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 301
source : AC1

5) chain A
residue 209
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 301
source : AC1

6) chain A
residue 176
type ACT_SITE
ligand
sequence E
description {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 171-187
type prosite
ligand
sequence IQMTAEVARFRYIQNLV
description Shiga/ricin ribosomal inactivating toxins active site signature. [LIVMA]-x-[LIVMSTA](2)-x-E-[SAGV]-[STAL]-R-[FY]-[RKNQST]-x-[LIVM]-[EQS]
source prosite : PS00275

8) chain A
residue 179
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1abr
source CSA : CSA1

9) chain A
residue 176
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1abr
source CSA : CSA1


Display surface

Download
Links