eF-site ID 1qao-A PDB Code 1qao Chain A click to enlarge Title THE STRUCTURE OF THE RRNA METHYLTRANSFERASE ERMC': IMPLICATIONS FOR THE REACTION MECHANISM Classification TRANSFERASE Compound ERMC' METHYLTRANSFERASE Source null (ERM_BACSU) Sequence A:  SQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLEL VQRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQF KFPKNQSYKIFGNIPYNISTDIIRKIVFDSIADEIYLIVE YGFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPK VNSSLIRLNRKKSRISHKDKQKYNYFVMKWVNKEYKKIFT KNQFNNSLKHAGIDDLNNISFEQFLSLFNSYKLFNK Description Functional site 1) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 2) chain A residue 12 type sequence F description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 3) chain A residue 13 type sequence I description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 4) chain A residue 36 type sequence E description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 5) chain A residue 38 type sequence G description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 6) chain A residue 39 type sequence S description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 7) chain A residue 40 type sequence G description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 8) chain A residue 44 type sequence F description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 9) chain A residue 58 type sequence I description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 10) chain A residue 59 type sequence E description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 11) chain A residue 60 type sequence I description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 12) chain A residue 64 type sequence L description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 13) chain A residue 83 type sequence K description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 14) chain A residue 84 type sequence D description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 15) chain A residue 85 type sequence I description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 16) chain A residue 101 type sequence N description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 17) chain A residue 103 type sequence P description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 18) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE SAM A 245 source : AC1 19) chain A residue 38 type catalytic sequence G description 898 source MCSA : MCSA1 20) chain A residue 59 type catalytic sequence E description 898 source MCSA : MCSA1 21) chain A residue 101 type catalytic sequence N description 898 source MCSA : MCSA1 22) chain A residue 104 type catalytic sequence Y description 898 source MCSA : MCSA1 23) chain A residue 163 type catalytic sequence F description 898 source MCSA : MCSA1 24) chain A residue 34-61 type prosite sequence IFEIGSGKGHFTLELVQRCNFVTAIEID description RRNA_A_DIMETH Ribosomal RNA adenine dimethylases signature. IFEiGSGkGhFTlelVqrcnf...VtAIEiD source prosite : PS01131 25) chain A residue 13 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 26) chain A residue 38 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 27) chain A residue 59 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 28) chain A residue 84 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 29) chain A residue 101 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 30) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links