eF-site ID 1qan-A PDB Code 1qan Chain A click to enlarge Title THE STRUCTURE OF THE RRNA METHYLTRANSFERASE ERMC': IMPLICATIONS FOR THE REACTION MECHANISM Classification TRANSFERASE Compound ERMC' METHYLTRANSFERASE Source null (ERM_BACSU) Sequence A:  SQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLEL VQRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQF KFPKNQSYKIFGNIPYNISTDIIRKIVFDSIADEIYLIVE YGFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPK VNSSLIRLNRKKSRISHKDKQKYNYFVMKWVNKEYKKIFT KNQFNNSLKHAGIDDLNNISFEQFLSLFNSYKLFNK Description Functional site 1) chain A residue 131 type sequence F description BINDING SITE FOR RESIDUE ACT A 901 source : AC1 2) chain A residue 134 type sequence R description BINDING SITE FOR RESIDUE ACT A 901 source : AC1 3) chain A residue 140 type sequence R description BINDING SITE FOR RESIDUE ACT A 901 source : AC1 4) chain A residue 142 type sequence L description BINDING SITE FOR RESIDUE ACT A 901 source : AC1 5) chain A residue 15 type sequence S description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 6) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 7) chain A residue 17 type sequence H description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 8) chain A residue 33 type sequence N description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 9) chain A residue 54 type sequence F description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 10) chain A residue 79 type sequence Q description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 11) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 12) chain A residue 12 type sequence F description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 13) chain A residue 13 type sequence I description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 14) chain A residue 38 type sequence G description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 15) chain A residue 39 type sequence S description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 16) chain A residue 40 type sequence G description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 17) chain A residue 43 type sequence H description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 18) chain A residue 59 type sequence E description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 19) chain A residue 60 type sequence I description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 20) chain A residue 64 type sequence L description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 21) chain A residue 84 type sequence D description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 22) chain A residue 85 type sequence I description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 23) chain A residue 101 type sequence N description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 24) chain A residue 103 type sequence P description BINDING SITE FOR RESIDUE SAH A 501 source : AC3 25) chain A residue 38 type catalytic sequence G description 898 source MCSA : MCSA1 26) chain A residue 59 type catalytic sequence E description 898 source MCSA : MCSA1 27) chain A residue 101 type catalytic sequence N description 898 source MCSA : MCSA1 28) chain A residue 104 type catalytic sequence Y description 898 source MCSA : MCSA1 29) chain A residue 163 type catalytic sequence F description 898 source MCSA : MCSA1 30) chain A residue 34-61 type prosite sequence IFEIGSGKGHFTLELVQRCNFVTAIEID description RRNA_A_DIMETH Ribosomal RNA adenine dimethylases signature. IFEiGSGkGhFTlelVqrcnf...VtAIEiD source prosite : PS01131 31) chain A residue 13 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 32) chain A residue 38 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 33) chain A residue 59 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 34) chain A residue 84 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 35) chain A residue 101 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 36) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links