eF-site ID 1qam-A PDB Code 1qam Chain A click to enlarge Title THE STRUCTURE OF THE RRNA METHYLTRANSFERASE ERMC': IMPLICATIONS FOR THE REACTION MECHANISM Classification TRANSFERASE Compound ERMC' METHYLTRANSFERASE Source Bacillus subtilis (ERM_BACSU) Sequence A:  QNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELV QRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFK FPKNQSYKIFGNIPYNISTDIIRKIVFDSIADEIYLIVEY GFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPKV NSSLIRLNRKKSRISHKDKQKYNYFVMKWVNKEYKKIFTK NQFNNSLKHAGIDDLNNISFEQFLSLFNSYKLFNK Description Functional site 1) chain A residue 131 type sequence F description BINDING SITE FOR RESIDUE ACT A 901 source : AC1 2) chain A residue 134 type sequence R description BINDING SITE FOR RESIDUE ACT A 901 source : AC1 3) chain A residue 140 type sequence R description BINDING SITE FOR RESIDUE ACT A 901 source : AC1 4) chain A residue 15 type sequence S description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 5) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 6) chain A residue 17 type sequence H description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 7) chain A residue 33 type sequence N description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 8) chain A residue 54 type sequence F description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 9) chain A residue 79 type sequence Q description BINDING SITE FOR RESIDUE ACT A 902 source : AC2 10) chain A residue 38 type catalytic sequence G description 898 source MCSA : MCSA1 11) chain A residue 59 type catalytic sequence E description 898 source MCSA : MCSA1 12) chain A residue 101 type catalytic sequence N description 898 source MCSA : MCSA1 13) chain A residue 104 type catalytic sequence Y description 898 source MCSA : MCSA1 14) chain A residue 163 type catalytic sequence F description 898 source MCSA : MCSA1 15) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 13 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 38 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 59 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 19) chain A residue 84 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 20) chain A residue 101 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 21) chain A residue 34-61 type prosite sequence IFEIGSGKGHFTLELVQRCNFVTAIEID description RRNA_A_DIMETH Ribosomal RNA adenine dimethylases signature. IFEiGSGkGhFTlelVqrcnf...VtAIEiD source prosite : PS01131

Display surface Download Links