eF-site ID 1q1q-A PDB Code 1q1q Chain A click to enlarge Title Crystal structure of human pregnenolone sulfotransferase (SULT2B1a) in the presence of PAP Classification TRANSFERASE Compound sulfotransferase family, cytosolic, 2B, member 1 isoform a Source Homo sapiens (Human) (ST2B1_HUMAN) Sequence A:  LPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFII TYPKSGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCET IVGASPRLMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVV VSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHI KGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLG KEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFL RKGVCGDWKNHFTVAQSEAFDRAYRKQMRGMPTFPWDE Description Functional site 1) chain A residue 145 type sequence S description BINDING SITE FOR RESIDUE NA A 351 source : AC1 2) chain A residue 148 type sequence A description BINDING SITE FOR RESIDUE NA A 351 source : AC1 3) chain A residue 151 type sequence L description BINDING SITE FOR RESIDUE NA A 351 source : AC1 4) chain A residue 153 type sequence D description BINDING SITE FOR RESIDUE NA A 351 source : AC1 5) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 6) chain A residue 56 type sequence S description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 7) chain A residue 57 type sequence G description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 8) chain A residue 58 type sequence T description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 9) chain A residue 59 type sequence T description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 10) chain A residue 60 type sequence W description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 11) chain A residue 132 type sequence R description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 12) chain A residue 140 type sequence S description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 13) chain A residue 195 type sequence Y description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 14) chain A residue 199 type sequence Q description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 15) chain A residue 229 type sequence S description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 16) chain A residue 231 type sequence F description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 17) chain A residue 234 type sequence M description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 18) chain A residue 257 type sequence F description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 19) chain A residue 258 type sequence L description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 20) chain A residue 259 type sequence R description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 21) chain A residue 260 type sequence K description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 22) chain A residue 261 type sequence G description BINDING SITE FOR RESIDUE A3P A 352 source : AC2 23) chain A residue 142 type sequence Y description BINDING SITE FOR RESIDUE NHE A 353 source : AC3 24) chain A residue 157 type sequence P description BINDING SITE FOR RESIDUE NHE A 353 source : AC3 25) chain A residue 161 type sequence L description BINDING SITE FOR RESIDUE NHE A 353 source : AC3 26) chain A residue 269 type sequence H description BINDING SITE FOR RESIDUE NHE A 353 source : AC3 27) chain A residue 29 type sequence Y description BINDING SITE FOR RESIDUE NHE A 354 source : AC4 28) chain A residue 54 type sequence P description BINDING SITE FOR RESIDUE NHE A 354 source : AC4 29) chain A residue 88 type sequence W description BINDING SITE FOR RESIDUE NHE A 354 source : AC4 30) chain A residue 144 type sequence Y description BINDING SITE FOR RESIDUE NHE A 354 source : AC4 31) chain A residue 150 type sequence Q description BINDING SITE FOR RESIDUE NHE A 354 source : AC4 32) chain A residue 170 type sequence Q description BINDING SITE FOR RESIDUE NHE A 354 source : AC4 33) chain A residue 171 type sequence F description BINDING SITE FOR RESIDUE NHE A 354 source : AC4 34) chain A residue 110 type ACT_SITE sequence H description Proton acceptor => ECO:0000250|UniProtKB:P49891 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 55 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:P49891 source Swiss-Prot : SWS_FT_FI2 36) chain A residue 132 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P49891 source Swiss-Prot : SWS_FT_FI2 37) chain A residue 140 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P49891 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 195 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P49891 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 229 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P49891 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 259 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P49891 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 83 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI3 42) chain A residue 88 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI3 43) chain A residue 110 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links