eF-site ID 1pyi-B PDB Code 1pyi Chain B click to enlarge Title CRYSTAL STRUCTURE OF A PPR1-DNA COMPLEX: DNA RECOGNITION BY PROTEINS CONTAINING A ZN2CYS6 BINUCLEAR CLUSTER Classification TRANSCRIPTION/DNA Compound DNA (5'-D(*TP*CP*GP*GP*CP*AP*AP*TP*TP*GP*CP*CP*GP*A)-3') Source null (1PYI) Sequence B:  SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATG KDVPRSYVFFLEDRLAVMMRVLKEYGVDPT Description Functional site 1) chain B residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 2) chain B residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 3) chain B residue 54 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 4) chain B residue 61 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 5) chain B residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 6) chain B residue 37 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 7) chain B residue 44 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 8) chain B residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 9) chain B residue 51 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 10) chain B residue 54 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 11) chain B residue 61 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 12) chain B residue 44 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 13) chain B residue 34 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 14) chain B residue 37 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 15) chain B residue 34-61 type DNA_BIND sequence CKRCRLKKIKCDQEFPSCKRCAKLEVPC description Zn(2)-C6 fungal-type => ECO:0000255|PROSITE-ProRule:PRU00227 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links