eF-site ID 1pyi-ABDE PDB Code 1pyi Chain A, B, D, E click to enlarge Title CRYSTAL STRUCTURE OF A PPR1-DNA COMPLEX: DNA RECOGNITION BY PROTEINS CONTAINING A ZN2CYS6 BINUCLEAR CLUSTER Classification TRANSCRIPTION/DNA Compound DNA (5'-D(*TP*CP*GP*GP*CP*AP*AP*TP*TP*GP*CP*CP*GP*A)-3') Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (1PYI) Sequence A:  SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATG KDVPRSYVFFLEDRLAVMMRVLKEYGVDPTKIRGNIPATS DDEPFDLK B:  SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATG KDVPRSYVFFLEDRLAVMMRVLKEYGVDPT D:  TCGGCAATTGCCGA E:  TCGGCAATTGCCGA Description Functional site 1) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 2) chain A residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 3) chain A residue 54 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 4) chain A residue 61 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 5) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 6) chain A residue 37 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 7) chain A residue 44 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 8) chain A residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 9) chain B residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 10) chain B residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 11) chain B residue 54 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 12) chain B residue 61 type sequence C description BINDING SITE FOR RESIDUE ZN B 321 source : AC3 13) chain B residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 14) chain B residue 37 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 15) chain B residue 44 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 16) chain B residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN B 322 source : AC4 17) chain A residue 33-61 type prosite sequence ACKRCRLKKIKCDQEFPSCKRCAKLEVPC description ZN2_CY6_FUNGAL_1 Zn(2)-C6 fungal-type DNA-binding domain signature. ACkrCRlkKikCdqefps......CkrCaklevp..C source prosite : PS00463 18) chain A residue 34-61 type DNA_BIND sequence CKRCRLKKIKCDQEFPSCKRCAKLEVPC description Zn(2)-C6 fungal-type => ECO:0000255|PROSITE-ProRule:PRU00227 source Swiss-Prot : SWS_FT_FI1 19) chain B residue 34-61 type DNA_BIND sequence CKRCRLKKIKCDQEFPSCKRCAKLEVPC description Zn(2)-C6 fungal-type => ECO:0000255|PROSITE-ProRule:PRU00227 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 34 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 21) chain B residue 51 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 22) chain B residue 54 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 23) chain B residue 61 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 37 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 44 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 51 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 27) chain A residue 54 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 28) chain A residue 61 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 29) chain B residue 34 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 30) chain B residue 37 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 31) chain B residue 44 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links