eF-site ID 1pyi-A PDB Code 1pyi Chain A click to enlarge Title CRYSTAL STRUCTURE OF A PPR1-DNA COMPLEX: DNA RECOGNITION BY PROTEINS CONTAINING A ZN2CYS6 BINUCLEAR CLUSTER Classification TRANSCRIPTION/DNA Compound DNA (5'-D(*TP*CP*GP*GP*CP*AP*AP*TP*TP*GP*CP*CP*GP*A)-3') Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (1PYI) Sequence A:  SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATG KDVPRSYVFFLEDRLAVMMRVLKEYGVDPTKIRGNIPATS DDEPFDLK Description Functional site 1) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 2) chain A residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 3) chain A residue 54 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 4) chain A residue 61 type sequence C description BINDING SITE FOR RESIDUE ZN A 21 source : AC1 5) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 6) chain A residue 37 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 7) chain A residue 44 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 8) chain A residue 51 type sequence C description BINDING SITE FOR RESIDUE ZN A 22 source : AC2 9) chain A residue 33-61 type prosite sequence ACKRCRLKKIKCDQEFPSCKRCAKLEVPC description ZN2_CY6_FUNGAL_1 Zn(2)-C6 fungal-type DNA-binding domain signature. ACkrCRlkKikCdqefps......CkrCaklevp..C source prosite : PS00463 10) chain A residue 34-61 type DNA_BIND sequence CKRCRLKKIKCDQEFPSCKRCAKLEVPC description Zn(2)-C6 fungal-type => ECO:0000255|PROSITE-ProRule:PRU00227 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 34 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 12) chain A residue 37 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 13) chain A residue 44 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 14) chain A residue 51 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 54 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 61 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links