eF-site ID 1ppz-A PDB Code 1ppz Chain A click to enlarge Title Trypsin complexes at atomic and ultra-high resolution Classification HYDROLASE Compound Trypsin Source ORGANISM_SCIENTIFIC: Fusarium oxysporum; Sequence A:  IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAA HCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSG NNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATV AGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAIT NQMFCAGVSSGGKDSCQGDXGGPIVDSSNTLIGAVSWGNG CARPNYSGVYASVGALRSFIDTYA Description (1)  Trypsin (E.C.3.4.21.4) Functional site 1) chain A residue 112 type sequence G description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 2) chain A residue 113 type sequence G description BINDING SITE FOR RESIDUE SO4 A 301 source : AC1 3) chain A residue 56 type catalytic sequence H description 173 source MCSA : MCSA1 4) chain A residue 99 type catalytic sequence D description 173 source MCSA : MCSA1 5) chain A residue 192 type catalytic sequence Q description 173 source MCSA : MCSA1 6) chain A residue 193 type catalytic sequence G description 173 source MCSA : MCSA1 7) chain A residue 194 type catalytic sequence D description 173 source MCSA : MCSA1 8) chain A residue 195 type catalytic sequence X description 173 source MCSA : MCSA1 9) chain A residue 52-57 type prosite sequence LTAAHC description TRYPSIN_HIS Serine proteases, trypsin family, histidine active site. LTAAHC source prosite : PS00134 10) chain A residue 189-200 type prosite sequence DSCQGDXGGPIV description TRYPSIN_SER Serine proteases, trypsin family, serine active site. DScqGDSGGPIV source prosite : PS00135 11) chain A residue 56 type ACT_SITE sequence H description Charge relay system source Swiss-Prot : SWS_FT_FI1 12) chain A residue 99 type ACT_SITE sequence D description Charge relay system source Swiss-Prot : SWS_FT_FI1 13) chain A residue 195 type ACT_SITE sequence X description Charge relay system source Swiss-Prot : SWS_FT_FI1 14) chain A residue 189 type SITE sequence D description Required for specificity source Swiss-Prot : SWS_FT_FI2

Display surface Download Links