eF-site ID 1pm5-ADE PDB Code 1pm5 Chain A, D, E click to enlarge Title Crystal structure of wild type Lactococcus lactis Fpg complexed to a tetrahydrofuran containing DNA Classification hydrolase/DNA Compound DNA (5'-D(*CP*TP*CP*TP*TP*TP*(3DR)P*TP*TP*TP*CP*TP*CP*G)-3') Source Lactococcus lactis subsp. cremoris (Streptococcus cremoris) (1PM5) Sequence A:  PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQL KKELTGKTIQGISRRGKYLIFEIGDDFRLISHLRMEGKYR LATLDAPREKHDHLTMKFADGQLIYADVRKFGTWELISTD QVLPYFLKKKIGPEPTYEDFDEKLFREKLRKSTKKIKPYL LEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLL HDSIIEILQKAIKLGGSSIRTYSALGSTGKMQNELQVYGK TGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK D:  CTCTTTXTTTCTCG E:  GCGAGAAACAAAGA Description Functional site 1) chain A residue 245 type sequence C description BINDING SITE FOR RESIDUE ZN A 300 source : AC1 2) chain A residue 248 type sequence C description BINDING SITE FOR RESIDUE ZN A 300 source : AC1 3) chain A residue 265 type sequence C description BINDING SITE FOR RESIDUE ZN A 300 source : AC1 4) chain A residue 268 type sequence C description BINDING SITE FOR RESIDUE ZN A 300 source : AC1 5) chain A residue 16 type sequence R description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 6) chain A residue 20 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 7) chain A residue 81 type sequence L description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 8) chain A residue 83 type sequence T description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 9) chain A residue 85 type sequence D description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 10) chain A residue 100 type sequence D description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 11) chain A residue 101 type sequence G description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 12) chain A residue 259 type sequence G description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 13) chain A residue 260 type sequence R description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 14) chain D residue 8 type sequence T description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 15) chain D residue 9 type sequence T description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 16) chain E residue 21 type sequence A description BINDING SITE FOR RESIDUE GOL A 1003 source : AC3 17) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 18) chain A residue 72 type sequence H description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 19) chain A residue 74 type sequence R description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 20) chain A residue 113 type sequence T description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 21) chain A residue 115 type sequence E description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 22) chain A residue 125 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 23) chain A residue 129 type sequence K description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 24) chain D residue 9 type sequence T description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 25) chain D residue 10 type sequence T description BINDING SITE FOR RESIDUE GOL A 1004 source : AC4 26) chain A residue 1 type ACT_SITE sequence P description Schiff-base intermediate with DNA => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 2 type ACT_SITE sequence E description Proton donor => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 28) chain A residue 57 type ACT_SITE sequence K description Proton donor; for beta-elimination activity => ECO:0000305 source Swiss-Prot : SWS_FT_FI4 29) chain A residue 261 type ACT_SITE sequence G description Proton donor; for delta-elimination activity => ECO:0000305 source Swiss-Prot : SWS_FT_FI5 30) chain A residue 237-271 type ZN_FING sequence VYGKTGEKCSRCGAEIQKIKVAGRGTHFCPVCQQK description FPG-type source Swiss-Prot : SWS_FT_FI1 31) chain A residue 245-269 type prosite sequence CSRCGAEIQKIKVAGRGTHFCPVCQ description ZF_FPG_1 Zinc finger FPG-type signature. Csr..CGaeIqkikvag....RGthFCpvCQ source prosite : PS01242 32) chain A residue 91 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI6 33) chain A residue 109 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI6

Display surface Download Links