eF-site ID 1pjf_19-A
PDB Code 1pjf
Model 19
Chain A

click to enlarge
Title Solid State NMR structure of the Pf1 Major Coat Protein in Magnetically Aligned Bacteriophage
Classification VIRAL PROTEIN
Compound COAT PROTEIN B
Source ORGANISM_SCIENTIFIC: Pseudomonas phage Pf1;
Sequence A:  GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIY
SMLRKA
Description (1)  Coat protein B precursor


Functional site

1) chain A
residue 22-42
type TRANSMEM
ligand
sequence IGGYIVGALVILAVAGLIYSM
description Helical.
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links