eF-site ID 1pe0-B
PDB Code 1pe0
Chain B

click to enlarge
Title Crystal structure of the K130R mutant of human DJ-1
Classification PROTEIN BINDING
Compound DJ-1
Source Homo sapiens (Human) (PARK7_HUMAN)
Sequence B:  ASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGK
DPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQN
LSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGS
KVTTHPLARDKMMNGGHYTYSENRVEKDGLILTSRGPGTS
FEFALAIVEALNGKEVAAQVKAPLVLK
Description (1)  DJ-1

Display surface

Download
Links