eF-site ID 1pdw-H PDB Code 1pdw Chain H click to enlarge Title Crystal structure of human DJ-1, P 1 21 1 space group Classification PROTEIN BINDING Compound DJ-1 Source Homo sapiens (Human) (PARK7_HUMAN) Sequence H:  ASKRALVILAKGAEEXETVIPVDVXRRAGIKVTVAGLAGK DPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQN LSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGS KVTTHPLAKDKXXNGGHYTYSENRVEKDGLILTSRGPGTS FEFALAIVEALNGKEVAAQVKAPLVLK Description (1)  DJ-1 Functional site 1) chain H residue 3267 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455 source Swiss-Prot : SWS_FT_FI5 2) chain H residue 3306 type MOD_RES sequence C description Cysteine sulfinic acid (-SO2H); alternate => ECO:0000269|PubMed:12939276 source Swiss-Prot : SWS_FT_FI6 3) chain H residue 3348 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q99LX0 source Swiss-Prot : SWS_FT_FI7 4) chain H residue 3306 type ACT_SITE sequence C description Nucleophile => ECO:0000305|PubMed:20304780, ECO:0000305|PubMed:25416785 source Swiss-Prot : SWS_FT_FI1 5) chain H residue 3326 type ACT_SITE sequence H description ACT_SITE => ECO:0000305|PubMed:20304780 source Swiss-Prot : SWS_FT_FI2 6) chain H residue 3349 type SITE sequence D description Cleavage; by CASP6 => ECO:0000250|UniProtKB:Q99LX0 source Swiss-Prot : SWS_FT_FI3 7) chain H residue 3202 type MOD_RES sequence A description N-acetylalanine => ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI4 8) chain H residue 3330 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:15976810 source Swiss-Prot : SWS_FT_FI11 9) chain H residue 3382 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:Q99LX0 source Swiss-Prot : SWS_FT_FI8 10) chain H residue 3246 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000269|PubMed:23847046 source Swiss-Prot : SWS_FT_FI9 11) chain H residue 3253 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000269|PubMed:23847046 source Swiss-Prot : SWS_FT_FI9 12) chain H residue 3306 type LIPID sequence C description S-palmitoyl cysteine; alternate => ECO:0000269|PubMed:23847046 source Swiss-Prot : SWS_FT_FI10

Display surface Download Links