eF-site ID 1pdw-E PDB Code 1pdw Chain E click to enlarge Title Crystal structure of human DJ-1, P 1 21 1 space group Classification PROTEIN BINDING Compound DJ-1 Source Homo sapiens (Human) (PARK7_HUMAN) Sequence E:  ASKRALVILAKGAEEXETVIPVDVXRRAGIKVTVAGLAGK DPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQN LSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGS KVTTHPLAKDKXXNGGHYTYSENRVEKDGLILTSRGPGTS FEFALAIVEALNGKEVAAQVKAPLVLKDL Description (1)  DJ-1 Functional site 1) chain E residue 2067 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455 source Swiss-Prot : SWS_FT_FI5 2) chain E residue 2106 type MOD_RES sequence C description Cysteine sulfinic acid (-SO2H); alternate => ECO:0000269|PubMed:12939276 source Swiss-Prot : SWS_FT_FI6 3) chain E residue 2148 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q99LX0 source Swiss-Prot : SWS_FT_FI7 4) chain E residue 2106 type ACT_SITE sequence C description Nucleophile => ECO:0000305|PubMed:20304780, ECO:0000305|PubMed:25416785 source Swiss-Prot : SWS_FT_FI1 5) chain E residue 2126 type ACT_SITE sequence H description ACT_SITE => ECO:0000305|PubMed:20304780 source Swiss-Prot : SWS_FT_FI2 6) chain E residue 2149 type SITE sequence D description Cleavage; by CASP6 => ECO:0000250|UniProtKB:Q99LX0 source Swiss-Prot : SWS_FT_FI3 7) chain E residue 2002 type MOD_RES sequence A description N-acetylalanine => ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI4 8) chain E residue 2130 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:15976810 source Swiss-Prot : SWS_FT_FI11 9) chain E residue 2182 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:Q99LX0 source Swiss-Prot : SWS_FT_FI8 10) chain E residue 2053 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000269|PubMed:23847046 source Swiss-Prot : SWS_FT_FI9 11) chain E residue 2046 type LIPID sequence C description S-palmitoyl cysteine => ECO:0000269|PubMed:23847046 source Swiss-Prot : SWS_FT_FI9 12) chain E residue 2106 type LIPID sequence C description S-palmitoyl cysteine; alternate => ECO:0000269|PubMed:23847046 source Swiss-Prot : SWS_FT_FI10

Display surface Download Links