eF-site ID 1pdw-B
PDB Code 1pdw
Chain B

click to enlarge
Title Crystal structure of human DJ-1, P 1 21 1 space group
Classification PROTEIN BINDING
Compound DJ-1
Source Homo sapiens (Human) (PARK7_HUMAN)
Sequence B:  ASKRALVILAKGAEEXETVIPVDVXRRAGIKVTVAGLAGK
DPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQN
LSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGS
KVTTHPLAKDKXXNGGHYTYSENRVEKDGLILTSRGPGTS
FEFALAIVEALNGKEVAAQVKAPLVLK
Description (1)  DJ-1

Display surface

Download
Links