eF-site ID 1pdw-A
PDB Code 1pdw
Chain A

click to enlarge
Title Crystal structure of human DJ-1, P 1 21 1 space group
Classification PROTEIN BINDING
Compound DJ-1
Source Homo sapiens (Human) (PARK7_HUMAN)
Sequence A:  ASKRALVILAKGAEEXETVIPVDVXRRAGIKVTVAGLAGK
DPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQN
LSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGS
KVTTHPLAKDKXXNGGHYTYSENRVEKDGLILTSRGPGTS
FEFALAIVEALNGKEVAAQVKAPLVLK
Description (1)  DJ-1


Functional site

1) chain A
residue 106
type ACT_SITE
ligand
sequence C
description Probable.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 126
type ACT_SITE
ligand
sequence H
description Probable.
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links