eF-site ID 1pb0-C
PDB Code 1pb0
Chain C

click to enlarge
Title YCDX PROTEIN IN AUTOINHIBITED STATE
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Hypothetical protein ycdX
Source Escherichia coli (strain K12) (YCDX_ECOLI)
Sequence C:  MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDH
GPDMEDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD
GEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIAT
IASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINFL
HNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILD
AVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL
Description (1)  Hypothetical protein ycdX


Functional site

1) chain C
residue 15
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

2) chain C
residue 40
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

3) chain C
residue 164
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

4) chain C
residue 194
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

5) chain C
residue 7
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

6) chain C
residue 9
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

7) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

8) chain C
residue 192
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

9) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN C 1323
source : AC9

10) chain C
residue 101
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1323
source : AC9

11) chain C
residue 131
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1323
source : AC9

12) chain C
residue 152
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 C 1344
source : BC3

13) chain C
residue 186
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 C 1344
source : BC3

14) chain C
residue 218
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 1344
source : BC3

15) chain C
residue 60
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FMT C 1336
source : BC7

16) chain C
residue 61
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT C 1336
source : BC7

17) chain C
residue 62
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT C 1336
source : BC7

18) chain C
residue 181
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT C 1317
source : BC9

19) chain C
residue 73
type METAL
ligand
sequence E
description Zinc 3
source Swiss-Prot : SWS_FT_FI7

20) chain C
residue 101
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI7

21) chain C
residue 131
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI7

22) chain C
residue 15
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI8

23) chain C
residue 40
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI8

24) chain C
residue 194
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI8

25) chain C
residue 7
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

26) chain C
residue 9
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

27) chain C
residue 73
type METAL
ligand
sequence E
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

28) chain C
residue 192
type METAL
ligand
sequence D
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

29) chain C
residue 59-62
type binding
ligand FMT: FORMIC ACID
sequence WPRV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1336

30) chain C
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1336

31) chain C
residue 178
type binding
ligand FMT: FORMIC ACID
sequence A
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1317

32) chain C
residue 181
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1317

33) chain C
residue 212
type binding
ligand FMT: FORMIC ACID
sequence V
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1317


Display surface

Download
Links