eF-site ID 1pb0-B
PDB Code 1pb0
Chain B

click to enlarge
Title YCDX PROTEIN IN AUTOINHIBITED STATE
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Hypothetical protein ycdX
Source Escherichia coli (strain K12) (YCDX_ECOLI)
Sequence B:  MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDH
GPDMEDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD
GEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIAT
IASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINFL
HNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILD
AVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL
Description (1)  Hypothetical protein ycdX


Functional site

1) chain B
residue 15
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

2) chain B
residue 40
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

3) chain B
residue 164
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

4) chain B
residue 194
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

5) chain B
residue 7
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

6) chain B
residue 9
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

7) chain B
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

8) chain B
residue 192
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

9) chain B
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN B 1313
source : AC6

10) chain B
residue 101
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1313
source : AC6

11) chain B
residue 131
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1313
source : AC6

12) chain B
residue 152
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 B 1334
source : BC2

13) chain B
residue 186
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 B 1334
source : BC2

14) chain B
residue 218
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 1334
source : BC2

15) chain B
residue 60
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FMT B 1326
source : BC6

16) chain B
residue 61
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT B 1326
source : BC6

17) chain B
residue 62
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT B 1326
source : BC6

18) chain B
residue 181
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT B 1307
source : BC8

19) chain B
residue 212
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT B 1307
source : BC8

20) chain B
residue 70
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT B 1318
source : CC1

21) chain B
residue 73
type METAL
ligand
sequence E
description Zinc 3
source Swiss-Prot : SWS_FT_FI4

22) chain B
residue 101
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI4

23) chain B
residue 131
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI4

24) chain B
residue 15
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI5

25) chain B
residue 40
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI5

26) chain B
residue 194
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI5

27) chain B
residue 7
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

28) chain B
residue 9
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

29) chain B
residue 73
type METAL
ligand
sequence E
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

30) chain B
residue 192
type METAL
ligand
sequence D
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

31) chain B
residue 57
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

32) chain B
residue 59
type binding
ligand FMT: FORMIC ACID
sequence W
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

33) chain B
residue 61
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

34) chain B
residue 70
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

35) chain B
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

36) chain B
residue 59-62
type binding
ligand FMT: FORMIC ACID
sequence WPRV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1326

37) chain B
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1326

38) chain B
residue 178
type binding
ligand FMT: FORMIC ACID
sequence A
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1307

39) chain B
residue 181
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1307

40) chain B
residue 211-212
type binding
ligand FMT: FORMIC ACID
sequence AV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1307


Display surface

Download
Links