eF-site ID 1pb0-ABC
PDB Code 1pb0
Chain A, B, C

click to enlarge
Title YCDX PROTEIN IN AUTOINHIBITED STATE
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Hypothetical protein ycdX
Source Escherichia coli (strain K12) (YCDX_ECOLI)
Sequence A:  MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDH
GPDMEDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD
GEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIAT
IASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINFL
HSNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKIL
DAVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL
B:  MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDH
GPDMEDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD
GEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIAT
IASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINFL
HNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILD
AVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL
C:  MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDH
GPDMEDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD
GEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIAT
IASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINFL
HNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKILD
AVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL
Description (1)  Hypothetical protein ycdX


Functional site

1) chain A
residue 15
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

2) chain A
residue 40
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

3) chain A
residue 164
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

4) chain A
residue 194
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

5) chain A
residue 7
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

6) chain A
residue 9
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

7) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

8) chain A
residue 192
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

9) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 1303
source : AC3

10) chain A
residue 101
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1303
source : AC3

11) chain A
residue 131
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1303
source : AC3

12) chain B
residue 15
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

13) chain B
residue 40
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

14) chain B
residue 164
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

15) chain B
residue 194
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1311
source : AC4

16) chain B
residue 7
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

17) chain B
residue 9
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

18) chain B
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

19) chain B
residue 192
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN B 1312
source : AC5

20) chain B
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN B 1313
source : AC6

21) chain B
residue 101
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1313
source : AC6

22) chain B
residue 131
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN B 1313
source : AC6

23) chain C
residue 15
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

24) chain C
residue 40
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

25) chain C
residue 164
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

26) chain C
residue 194
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1321
source : AC7

27) chain C
residue 7
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

28) chain C
residue 9
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

29) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

30) chain C
residue 192
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN C 1322
source : AC8

31) chain C
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN C 1323
source : AC9

32) chain C
residue 101
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1323
source : AC9

33) chain C
residue 131
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN C 1323
source : AC9

34) chain A
residue 152
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 A 1324
source : BC1

35) chain A
residue 186
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 A 1324
source : BC1

36) chain A
residue 218
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 1324
source : BC1

37) chain B
residue 152
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 B 1334
source : BC2

38) chain B
residue 186
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 B 1334
source : BC2

39) chain B
residue 218
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 1334
source : BC2

40) chain C
residue 152
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 C 1344
source : BC3

41) chain C
residue 186
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 C 1344
source : BC3

42) chain C
residue 218
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 1344
source : BC3

43) chain A
residue 70
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 1305
source : BC4

44) chain A
residue 61
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT A 1306
source : BC5

45) chain A
residue 62
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT A 1306
source : BC5

46) chain B
residue 60
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FMT B 1326
source : BC6

47) chain B
residue 61
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT B 1326
source : BC6

48) chain B
residue 62
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT B 1326
source : BC6

49) chain C
residue 60
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FMT C 1336
source : BC7

50) chain C
residue 61
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT C 1336
source : BC7

51) chain C
residue 62
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT C 1336
source : BC7

52) chain B
residue 181
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT B 1307
source : BC8

53) chain B
residue 212
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT B 1307
source : BC8

54) chain C
residue 181
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT C 1317
source : BC9

55) chain B
residue 70
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT B 1318
source : CC1

56) chain A
residue 73
type METAL
ligand
sequence E
description Zinc 3
source Swiss-Prot : SWS_FT_FI1

57) chain A
residue 101
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI1

58) chain A
residue 131
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI1

59) chain A
residue 15
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI2

60) chain A
residue 40
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI2

61) chain A
residue 194
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI2

62) chain A
residue 7
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

63) chain A
residue 9
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

64) chain A
residue 73
type METAL
ligand
sequence E
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

65) chain A
residue 192
type METAL
ligand
sequence D
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

66) chain B
residue 73
type METAL
ligand
sequence E
description Zinc 3
source Swiss-Prot : SWS_FT_FI4

67) chain B
residue 101
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI4

68) chain B
residue 131
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI4

69) chain B
residue 15
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI5

70) chain B
residue 40
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI5

71) chain B
residue 194
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI5

72) chain B
residue 7
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

73) chain B
residue 9
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

74) chain B
residue 73
type METAL
ligand
sequence E
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

75) chain B
residue 192
type METAL
ligand
sequence D
description Zinc 1
source Swiss-Prot : SWS_FT_FI6

76) chain C
residue 73
type METAL
ligand
sequence E
description Zinc 3
source Swiss-Prot : SWS_FT_FI7

77) chain C
residue 101
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI7

78) chain C
residue 131
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI7

79) chain C
residue 15
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI8

80) chain C
residue 40
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI8

81) chain C
residue 194
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI8

82) chain C
residue 7
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

83) chain C
residue 9
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

84) chain C
residue 73
type METAL
ligand
sequence E
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

85) chain C
residue 192
type METAL
ligand
sequence D
description Zinc 1
source Swiss-Prot : SWS_FT_FI9

86) chain A
residue 59-62
type binding
ligand FMT: FORMIC ACID
sequence WPRV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_A_1306

87) chain A
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_A_1306

88) chain B
residue 57
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

89) chain B
residue 59
type binding
ligand FMT: FORMIC ACID
sequence W
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

90) chain B
residue 61
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

91) chain B
residue 70
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

92) chain B
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1318

93) chain B
residue 59-62
type binding
ligand FMT: FORMIC ACID
sequence WPRV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1326

94) chain B
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1326

95) chain B
residue 178
type binding
ligand FMT: FORMIC ACID
sequence A
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1307

96) chain B
residue 181
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1307

97) chain B
residue 211-212
type binding
ligand FMT: FORMIC ACID
sequence AV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_B_1307

98) chain C
residue 59-62
type binding
ligand FMT: FORMIC ACID
sequence WPRV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1336

99) chain C
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1336

100) chain C
residue 178
type binding
ligand FMT: FORMIC ACID
sequence A
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1317

101) chain C
residue 181
type binding
ligand FMT: FORMIC ACID
sequence R
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1317

102) chain C
residue 212
type binding
ligand FMT: FORMIC ACID
sequence V
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_C_1317


Display surface

Download
Links