eF-site ID 1pb0-A
PDB Code 1pb0
Chain A

click to enlarge
Title YCDX PROTEIN IN AUTOINHIBITED STATE
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Hypothetical protein ycdX
Source Escherichia coli (strain K12) (YCDX_ECOLI)
Sequence A:  MYPVDLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDH
GPDMEDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD
GEIDCSGKMFDSLDLIIAGFHEPVFAPHDKATNTQAMIAT
IASGNVHIISHPGNPKYEIDVKAVAEAAAKHQVALEINFL
HSNCREVAAAVRDAGGWVALGSDSHTAFTMGEFEECLKIL
DAVDFPPERILNVSPRRLLNFLESRGMAPIAEFADL
Description (1)  Hypothetical protein ycdX


Functional site

1) chain A
residue 15
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

2) chain A
residue 40
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

3) chain A
residue 164
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

4) chain A
residue 194
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1301
source : AC1

5) chain A
residue 7
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

6) chain A
residue 9
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

7) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

8) chain A
residue 192
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ZN A 1302
source : AC2

9) chain A
residue 73
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ZN A 1303
source : AC3

10) chain A
residue 101
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1303
source : AC3

11) chain A
residue 131
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 1303
source : AC3

12) chain A
residue 152
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 A 1324
source : BC1

13) chain A
residue 186
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SO4 A 1324
source : BC1

14) chain A
residue 218
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 1324
source : BC1

15) chain A
residue 70
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 1305
source : BC4

16) chain A
residue 61
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMT A 1306
source : BC5

17) chain A
residue 62
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMT A 1306
source : BC5

18) chain A
residue 73
type METAL
ligand
sequence E
description Zinc 3
source Swiss-Prot : SWS_FT_FI1

19) chain A
residue 101
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI1

20) chain A
residue 131
type METAL
ligand
sequence H
description Zinc 3
source Swiss-Prot : SWS_FT_FI1

21) chain A
residue 15
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI2

22) chain A
residue 40
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI2

23) chain A
residue 194
type METAL
ligand
sequence H
description Zinc 2
source Swiss-Prot : SWS_FT_FI2

24) chain A
residue 7
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

25) chain A
residue 9
type METAL
ligand
sequence H
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

26) chain A
residue 73
type METAL
ligand
sequence E
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

27) chain A
residue 192
type METAL
ligand
sequence D
description Zinc 1
source Swiss-Prot : SWS_FT_FI3

28) chain A
residue 59-62
type binding
ligand FMT: FORMIC ACID
sequence WPRV
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_A_1306

29) chain A
residue 241
type binding
ligand FMT: FORMIC ACID
sequence E
description FORMIC ACID binding site
source pdb_hetatom : FMT_1pb0_A_1306


Display surface

Download
Links