eF-site ID 1pa7-A PDB Code 1pa7 Chain A click to enlarge Title Crystal structure of amino-terminal microtubule binding domain of EB1 Classification STRUCTURAL PROTEIN Compound Microtubule-associated protein RP/EB family member 1 Source Homo sapiens (Human) (MARE1_HUMAN) Sequence A:  MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCS GAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQA GFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD GKDYDPVAAR Description Functional site 1) chain A residue 16 type sequence S description BINDING SITE FOR RESIDUE SO4 A 200 source : AC1 2) chain A residue 17 type sequence R description BINDING SITE FOR RESIDUE SO4 A 200 source : AC1 3) chain A residue 18 type sequence H description BINDING SITE FOR RESIDUE SO4 A 200 source : AC1 4) chain A residue 6 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 201 source : AC2 5) chain A residue 7 type sequence S description BINDING SITE FOR RESIDUE SO4 A 201 source : AC2 6) chain A residue 124 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 66 type MOD_RES sequence K description N6-crotonyllysine => ECO:0000269|PubMed:34608293 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 2 type MOD_RES sequence A description N-acetylalanine => ECO:0000269|Ref.6, ECO:0007744|PubMed:19413330, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links