eF-site ID 1p77-A PDB Code 1p77 Chain A click to enlarge Title CRYSTAL STRUCTURE OF SHIKIMATE DEHYDROGENASE (AROE) FROM HAEMOPHILUS INFLUENZAE Classification OXIDOREDUCTASE Compound Shikimate 5-dehydrogenase Source Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (AROE_HAEIN) Sequence A:  MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDL DAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAK LAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQ HVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAE RFQPYGNIQAVSMDSIPLQTYDLVINATSASVDAEILKLG SAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAA HSFHLWRGVMPDFVSVYEQLKKAML Description Functional site 1) chain A residue 1 type sequence M description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 2) chain A residue 89 type sequence K description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 3) chain A residue 177 type sequence P description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 4) chain A residue 179 type sequence Q description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 5) chain A residue 253 type sequence W description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 6) chain A residue 254 type sequence R description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 7) chain A residue 255 type sequence G description BINDING SITE FOR RESIDUE ACT A 301 source : AC1 8) chain A residue 126 type sequence G description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 9) chain A residue 127 type sequence A description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 10) chain A residue 128 type sequence G description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 11) chain A residue 129 type sequence G description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 12) chain A residue 130 type sequence A description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 13) chain A residue 149 type sequence N description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 14) chain A residue 150 type sequence R description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 15) chain A residue 151 type sequence T description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 16) chain A residue 154 type sequence K description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 17) chain A residue 188 type sequence T description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 18) chain A residue 189 type sequence S description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 19) chain A residue 190 type sequence A description BINDING SITE FOR RESIDUE ATR A 300 source : AC2 20) chain A residue 65 type ACT_SITE sequence K description Proton acceptor => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 14 type BINDING sequence S description BINDING => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 61 type BINDING sequence T description BINDING => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 86 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 102 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 213 type BINDING sequence M description BINDING => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 215 type BINDING sequence Y description BINDING => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 238 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00222 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 126 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00222, ECO:0000269|PubMed:12837789 source Swiss-Prot : SWS_FT_FI3 29) chain A residue 149 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00222, ECO:0000269|PubMed:12837789 source Swiss-Prot : SWS_FT_FI3 30) chain A residue 189 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12837789 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links