eF-site ID 1p6n-A PDB Code 1p6n Chain A click to enlarge Title Bovine endothelial NOS heme domain with L-N(omega)-nitroarginine-(4R)-amino-L-proline amide bound Classification OXIDOREDUCTASE Compound Nitric-oxide synthase, endothelial Source null (NOS3_BOVIN) Sequence A:  GPKFPRVKNWELGSITYDTLCAQSQQDGPCTPRRCLGSLV LPRPPAEQLLSQARDFINQYYSSIKRSGSQAHEERLQEVE AEVASTGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQ VFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQR APGRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELC IQHGWTPGNGRFDVLPLLLQAPDEAPELFVLPPELVLEVP LEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFSAAPFS GWYMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLW KDKAAVEINLAVLHSFQLAKVTIVDHHAATVSFMKHLDNE QKARGGCPADWAWIVPPISGSLTPVFHQEMVNYILSPAFR YQPDPW Description Functional site 1) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE CAC A 850 source : AC1 2) chain A residue 440 type sequence R description BINDING SITE FOR RESIDUE CAC A 850 source : AC1 3) chain A residue 441 type sequence G description BINDING SITE FOR RESIDUE CAC A 850 source : AC1 4) chain A residue 188 type sequence G description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 5) chain A residue 190 type sequence I description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 6) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 7) chain A residue 428 type sequence S description BINDING SITE FOR RESIDUE ACT A 860 source : AC2 8) chain A residue 96 type sequence C description BINDING SITE FOR RESIDUE ZN B 900 source : AC5 9) chain A residue 101 type sequence C description BINDING SITE FOR RESIDUE ZN B 900 source : AC5 10) chain A residue 180 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 11) chain A residue 185 type sequence R description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 12) chain A residue 186 type sequence C description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 13) chain A residue 187 type sequence V description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 14) chain A residue 228 type sequence S description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 15) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 16) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 17) chain A residue 360 type sequence M description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 18) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 19) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 20) chain A residue 475 type sequence F description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 21) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE HEM A 500 source : AC6 22) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE H4B A 760 source : AC7 23) chain A residue 106 type sequence V description BINDING SITE FOR RESIDUE H4B A 760 source : AC7 24) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE H4B A 760 source : AC7 25) chain A residue 448 type sequence A description BINDING SITE FOR RESIDUE H4B A 760 source : AC7 26) chain A residue 449 type sequence W description BINDING SITE FOR RESIDUE H4B A 760 source : AC7 27) chain A residue 106 type sequence V description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 28) chain A residue 249 type sequence Q description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 29) chain A residue 252 type sequence R description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 30) chain A residue 336 type sequence P description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 31) chain A residue 355 type sequence F description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 32) chain A residue 356 type sequence S description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 33) chain A residue 357 type sequence G description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 34) chain A residue 358 type sequence W description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 35) chain A residue 363 type sequence E description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 36) chain A residue 477 type sequence Y description BINDING SITE FOR RESIDUE DP9 A 799 source : AC8 37) chain A residue 447 type sequence W description BINDING SITE FOR RESIDUE H4B B 761 source : BC1 38) chain A residue 462 type sequence F description BINDING SITE FOR RESIDUE H4B B 761 source : BC1 39) chain A residue 465 type sequence E description BINDING SITE FOR RESIDUE H4B B 761 source : BC1 40) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE GOL B 880 source : BC3 41) chain A residue 76 type sequence W description BINDING SITE FOR RESIDUE GOL B 882 source : BC4 42) chain A residue 187 type BINDING sequence V description axial binding residue => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI3 43) chain A residue 185-192 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 44) chain A residue 97 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 45) chain A residue 102 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P35228 source Swiss-Prot : SWS_FT_FI1 46) chain A residue 105 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 47) chain A residue 250 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 48) chain A residue 478 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 49) chain A residue 359 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 50) chain A residue 360 type BINDING sequence M description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 51) chain A residue 364 type BINDING sequence I description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 52) chain A residue 369 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 53) chain A residue 449 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 54) chain A residue 450 type BINDING sequence I description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2 55) chain A residue 463 type BINDING sequence H description BINDING => ECO:0000250|UniProtKB:P29474 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links