eF-site ID 1p5w-A
PDB Code 1p5w
Chain A

click to enlarge
Title The structures of host range controlling regions of the capsids of canine and feline parvoviruses and mutants
Classification Virus/DNA
Compound 5'-D(P*(3DR)P*TP*AP*CP*CP*TP*CP*TP*TP*GP*C)-3'
Source Canine parvovirustype 2 (isolate Dog/United States/CPV-d/1988) (CPV-2) (1P5W)
Sequence A:  GVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPES
ENYRRVVVNNMDKTAVRGNMALDDIHAQIVTPWSLVDANA
WGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSEP
PTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYPW
KPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNIYHGTDPDD
VQFYTIENSVPVHLLRTGDEFATGTFFFDCKPCRLTHTWQ
TNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMG
NTNYITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAG
RGGAQTDENQAADGNPRYAFGRQHGQKTTTTGETPERFTY
IAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTDPIGGKT
GINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKP
RLHVNAPFVCQNNCPGQLFVKVAPNLTNEYDPDASANMSR
IVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFN
YVPSNIGGMKIVYEKSQLAPRKLY
Description (1)  Coat protein VP2 /DNA Complex


Functional site

1) chain A
residue 180
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MG B 101
source : AC1

2) chain A
residue 237
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A 585
source : AC3

3) chain A
residue 240
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A 585
source : AC3

4) chain A
residue 237
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A 586
source : AC4

5) chain A
residue 239
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG A 586
source : AC4

6) chain A
residue 144
type METAL
ligand
sequence E
description Magnesium 1
source Swiss-Prot : SWS_FT_FI1


Display surface

Download
Links