eF-site ID 1p3m-F PDB Code 1p3m Chain F click to enlarge Title Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants Classification STRUCTURAL PROTEIN/DNA Compound Palindromic 146bp Human Alpha-Satellite DNA fragment Source null (1P3M) Sequence F:  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF GG Description Functional site 1) chain F residue 292 type MOD_RES sequence R description N6-methyllysine => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI13 2) chain F residue 245 type MOD_RES sequence R description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 3) chain F residue 280 type MOD_RES sequence T description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 4) chain F residue 221 type MOD_RES sequence V description N5-methylglutamine => ECO:0000250 source Swiss-Prot : SWS_FT_FI6 5) chain F residue 232 type MOD_RES sequence P description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI7 6) chain F residue 292 type MOD_RES sequence R description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI7 7) chain F residue 252 type MOD_RES sequence E description N6-lactoyllysine; alternate => ECO:0000250|UniProtKB:P84228 source Swiss-Prot : SWS_FT_FI9 8) chain F residue 289 type MOD_RES sequence A description N6-lactoyllysine; alternate => ECO:0000250|UniProtKB:P84228 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links