eF-site ID 1p3g-C
PDB Code 1p3g
Chain C

click to enlarge
Title Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
Classification STRUCTURAL PROTEIN/DNA
Compound Palindromic 146bp Human Alpha-Satellite DNA fragment
Source Xenopus laevis (African clawed frog) (1P3G)
Sequence C:  AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA
VLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLP
Description (1)  Nucleosome Core Particle/DNA Complex

Display surface

Download
Links