eF-site ID 1p3g-C
PDB Code 1p3g
Chain C

click to enlarge
Title Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
Classification STRUCTURAL PROTEIN/DNA
Compound Palindromic 146bp Human Alpha-Satellite DNA fragment
Source Xenopus laevis (African clawed frog) (1P3G)
Sequence C:  AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAA
VLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLP
Description (1)  Nucleosome Core Particle/DNA Complex


Functional site

1) chain C
residue 821-827
type prosite
ligand
sequence AGLQFPV
description Histone H2A signature.[AC]-G-L-x-F-P-V.
source prosite : PS00046


Display surface

Download
Links