eF-site ID 1p33-D PDB Code 1p33 Chain D click to enlarge Title Pteridine reductase from Leishmania tarentolae complex with NADPH and MTX Classification OXIDOREDUCTASE Compound Pteridine reductase 1 Source Leishmania tarentolae (Sauroleishmania tarentolae) (PTR1_LEITA) Sequence D:  TAPVALVTGAAKRLGSSIAEALHAEGYTVCLHYHRSAADA STLAATLNARRPNSAITVQADLSNVATASSVPVTLFSRCS ALVDACYMHWGRCDVLVNNASSFYPTPLLRKDKESLEVAA ADLFGSNAIAPYFLIKAFAQRVADTRAEQRGTSYSIVNMV DAMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVN GVSPGLSVLPDDMPFSVQEDYRRKVPLYQRNSSAEEVSDV VIFLCSPKAKYITGTCIKVDGGYSLTRA Description Functional site 1) chain D residue 13 type sequence G description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 2) chain D residue 15 type sequence A description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 3) chain D residue 17 type sequence R description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 4) chain D residue 18 type sequence L description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 5) chain D residue 38 type sequence H description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 6) chain D residue 39 type sequence R description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 7) chain D residue 40 type sequence S description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 8) chain D residue 66 type sequence L description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 9) chain D residue 67 type sequence S description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 10) chain D residue 109 type sequence N description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 11) chain D residue 110 type sequence A description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 12) chain D residue 111 type sequence S description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 13) chain D residue 112 type sequence S description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 14) chain D residue 142 type sequence D description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 15) chain D residue 179 type sequence M description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 16) chain D residue 180 type sequence V description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 17) chain D residue 194 type sequence Y description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 18) chain D residue 198 type sequence K description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 19) chain D residue 224 type sequence P description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 20) chain D residue 225 type sequence G description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 21) chain D residue 227 type sequence S description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 22) chain D residue 228 type sequence V description BINDING SITE FOR RESIDUE NDP D 303 source : AC4 23) chain D residue 17 type sequence R description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 24) chain D residue 111 type sequence S description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 25) chain D residue 113 type sequence F description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 26) chain D residue 115 type sequence P description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 27) chain D residue 181 type sequence D description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 28) chain D residue 191 type sequence Y description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 29) chain D residue 194 type sequence Y description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 30) chain D residue 229 type sequence L description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 31) chain D residue 230 type sequence P description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 32) chain D residue 233 type sequence M description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 33) chain D residue 241 type sequence Y description BINDING SITE FOR RESIDUE MTX D 354 source : AC8 34) chain D residue 194 type ACT_SITE sequence Y description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU10001 source Swiss-Prot : SWS_FT_FI1 35) chain D residue 13 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12925782 source Swiss-Prot : SWS_FT_FI2 36) chain D residue 194 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12925782 source Swiss-Prot : SWS_FT_FI2 37) chain D residue 175 type BINDING sequence S description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links