eF-site ID 1p33-A PDB Code 1p33 Chain A click to enlarge Title Pteridine reductase from Leishmania tarentolae complex with NADPH and MTX Classification OXIDOREDUCTASE Compound Pteridine reductase 1 Source null (PTR1_LEITA) Sequence A:  TAPVALVTGAAKRLGSSIAEALHAEGYTVCLHYHRSAADA STLAATLNARRPNSAITVQADLSNVATASSVPVTLFSRCS ALVDACYMHWGRCDVLVNNASSFYPTPLLRDKESLEVAAA DLFGSNAIAPYFLIKAFAQRVADTRAEQRGTSYSIVNMVD AMTSQPLLGYTMYTMAKEALEGLTRSAALELASLQIRVNG VSPGLSVLPDDMPFSVQEDYRRKVPLYQRNSSAEEVSDVV IFLCSPKAKYITGTCIKVDGGYSLTRA Description Functional site 1) chain A residue 13 type sequence G description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 2) chain A residue 17 type sequence R description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 3) chain A residue 18 type sequence L description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 4) chain A residue 38 type sequence H description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 5) chain A residue 39 type sequence R description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 6) chain A residue 40 type sequence S description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 7) chain A residue 64 type sequence A description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 8) chain A residue 65 type sequence D description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 9) chain A residue 66 type sequence L description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 10) chain A residue 67 type sequence S description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 11) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 12) chain A residue 110 type sequence A description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 13) chain A residue 111 type sequence S description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 14) chain A residue 112 type sequence S description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 15) chain A residue 142 type sequence D description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 16) chain A residue 179 type sequence M description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 17) chain A residue 180 type sequence V description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 18) chain A residue 181 type sequence D description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 19) chain A residue 194 type sequence Y description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 20) chain A residue 198 type sequence K description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 21) chain A residue 224 type sequence P description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 22) chain A residue 225 type sequence G description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 23) chain A residue 226 type sequence L description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 24) chain A residue 227 type sequence S description BINDING SITE FOR RESIDUE NDP A 300 source : AC1 25) chain A residue 17 type sequence R description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 26) chain A residue 111 type sequence S description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 27) chain A residue 113 type sequence F description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 28) chain A residue 115 type sequence P description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 29) chain A residue 181 type sequence D description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 30) chain A residue 188 type sequence L description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 31) chain A residue 191 type sequence Y description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 32) chain A residue 194 type sequence Y description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 33) chain A residue 226 type sequence L description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 34) chain A residue 229 type sequence L description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 35) chain A residue 230 type sequence P description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 36) chain A residue 241 type sequence Y description BINDING SITE FOR RESIDUE MTX A 351 source : AC5 37) chain A residue 194 type ACT_SITE sequence Y description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU10001 source Swiss-Prot : SWS_FT_FI1 38) chain A residue 194 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:12925782 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 13 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12925782 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 175 type BINDING sequence S description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 41) chain A residue 181-209 type prosite sequence DAMTSQPLLGYTMYTMAKEALEGLTRSAA description ADH_SHORT Short-chain dehydrogenases/reductases family signature. DamtsqpllgYtmYTMAKEALeGLTrSAA source prosite : PS00061

Display surface Download Links