eF-site ID 1oqb-D PDB Code 1oqb Chain D click to enlarge Title The Crystal Structure of the one-iron form of the di-iron center in Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean). Classification OXIDOREDUCTASE Compound Acyl-[acyl-carrier protein] desaturase Source Ricinus communis (Castor bean) (STAD_RICCO) Sequence D:  FMPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKP VEKCWQPQDFLPDPASDGFDEQVRELRERAKEIPDDYFVV LVGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIWTR AWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGM DPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGDIK LAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFAD MMRKKISMPAHLMYDGRDDNLFDHFSAVAQRLGVYTAKDY ADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPPRIRRL EERAQGRAKEAPTMPFSWIFDRQVKL Description Functional site 1) chain D residue 105 type sequence E description BINDING SITE FOR RESIDUE FE2 D 364 source : AC4 2) chain D residue 143 type sequence E description BINDING SITE FOR RESIDUE FE2 D 364 source : AC4 3) chain D residue 146 type sequence H description BINDING SITE FOR RESIDUE FE2 D 364 source : AC4 4) chain D residue 229 type sequence E description BINDING SITE FOR RESIDUE FE2 D 364 source : AC4 5) chain D residue 62 type catalytic sequence W description 136 source MCSA : MCSA4 6) chain D residue 105 type catalytic sequence E description 136 source MCSA : MCSA4 7) chain D residue 143 type catalytic sequence E description 136 source MCSA : MCSA4 8) chain D residue 146 type catalytic sequence H description 136 source MCSA : MCSA4 9) chain D residue 196 type catalytic sequence E description 136 source MCSA : MCSA4 10) chain D residue 199 type catalytic sequence T description 136 source MCSA : MCSA4 11) chain D residue 228 type catalytic sequence D description 136 source MCSA : MCSA4 12) chain D residue 229 type catalytic sequence E description 136 source MCSA : MCSA4 13) chain D residue 232 type catalytic sequence H description 136 source MCSA : MCSA4 14) chain D residue 105 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 15) chain D residue 143 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 16) chain D residue 146 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 17) chain D residue 196 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 18) chain D residue 229 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 19) chain D residue 232 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links