eF-site ID 1oqb-C PDB Code 1oqb Chain C click to enlarge Title The Crystal Structure of the one-iron form of the di-iron center in Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean). Classification OXIDOREDUCTASE Compound Acyl-[acyl-carrier protein] desaturase Source Ricinus communis (Castor bean) (STAD_RICCO) Sequence C:  FMPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKP VEKCWQPQDFLPDPASDGFDEQVRELRERAKEIPDDYFVV LVGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIWTR AWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGM DPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGDIK LAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFAD MMRKKISMPAHLMYDGRDDNLFDHFSAVAQRLGVYTAKDY ADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPPRIRRL EERAQGRAKEAPTMPFSWIFDRQVKL Description Functional site 1) chain C residue 105 type sequence E description BINDING SITE FOR RESIDUE FE2 C 364 source : AC3 2) chain C residue 143 type sequence E description BINDING SITE FOR RESIDUE FE2 C 364 source : AC3 3) chain C residue 146 type sequence H description BINDING SITE FOR RESIDUE FE2 C 364 source : AC3 4) chain C residue 229 type sequence E description BINDING SITE FOR RESIDUE FE2 C 364 source : AC3 5) chain C residue 62 type catalytic sequence W description 136 source MCSA : MCSA3 6) chain C residue 105 type catalytic sequence E description 136 source MCSA : MCSA3 7) chain C residue 143 type catalytic sequence E description 136 source MCSA : MCSA3 8) chain C residue 146 type catalytic sequence H description 136 source MCSA : MCSA3 9) chain C residue 196 type catalytic sequence E description 136 source MCSA : MCSA3 10) chain C residue 199 type catalytic sequence T description 136 source MCSA : MCSA3 11) chain C residue 228 type catalytic sequence D description 136 source MCSA : MCSA3 12) chain C residue 229 type catalytic sequence E description 136 source MCSA : MCSA3 13) chain C residue 232 type catalytic sequence H description 136 source MCSA : MCSA3 14) chain C residue 105 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 15) chain C residue 143 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 16) chain C residue 146 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 17) chain C residue 196 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 18) chain C residue 229 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 19) chain C residue 232 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links