eF-site ID 1oq9-A PDB Code 1oq9 Chain A click to enlarge Title The Crystal Structure of the Complex between Stearoyl Acyl Carrier Protein Desaturase from Ricinus Communis (Castor Bean) and Acetate. Classification OXIDOREDUCTASE Compound Acyl-[acyl-carrier protein] desaturase Source Ricinus communis (Castor bean) (STAD_RICCO) Sequence A:  FMPPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKP VEKCWQPQDFLPDPASDGFDEQVRELRERAKEIPDDYFVV LVGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIWTR AWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGM DPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGDIK LAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFAD MMRKKISMPAHLMYDGRDDNLFDHFSAVAQRLGVYTAKDY ADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPPRIRRL KEAPTMPFSWIFDRQVKL Description Functional site 1) chain A residue 105 type sequence E description BINDING SITE FOR RESIDUE FE A 364 source : AC1 2) chain A residue 143 type sequence E description BINDING SITE FOR RESIDUE FE A 364 source : AC1 3) chain A residue 146 type sequence H description BINDING SITE FOR RESIDUE FE A 364 source : AC1 4) chain A residue 229 type sequence E description BINDING SITE FOR RESIDUE FE A 364 source : AC1 5) chain A residue 143 type sequence E description BINDING SITE FOR RESIDUE FE A 365 source : AC2 6) chain A residue 196 type sequence E description BINDING SITE FOR RESIDUE FE A 365 source : AC2 7) chain A residue 229 type sequence E description BINDING SITE FOR RESIDUE FE A 365 source : AC2 8) chain A residue 232 type sequence H description BINDING SITE FOR RESIDUE FE A 365 source : AC2 9) chain A residue 105 type sequence E description BINDING SITE FOR RESIDUE ACT A 366 source : AC3 10) chain A residue 143 type sequence E description BINDING SITE FOR RESIDUE ACT A 366 source : AC3 11) chain A residue 196 type sequence E description BINDING SITE FOR RESIDUE ACT A 366 source : AC3 12) chain A residue 199 type sequence T description BINDING SITE FOR RESIDUE ACT A 366 source : AC3 13) chain A residue 229 type sequence E description BINDING SITE FOR RESIDUE ACT A 366 source : AC3 14) chain A residue 62 type catalytic sequence W description 136 source MCSA : MCSA1 15) chain A residue 105 type catalytic sequence E description 136 source MCSA : MCSA1 16) chain A residue 143 type catalytic sequence E description 136 source MCSA : MCSA1 17) chain A residue 146 type catalytic sequence H description 136 source MCSA : MCSA1 18) chain A residue 196 type catalytic sequence E description 136 source MCSA : MCSA1 19) chain A residue 199 type catalytic sequence T description 136 source MCSA : MCSA1 20) chain A residue 228 type catalytic sequence D description 136 source MCSA : MCSA1 21) chain A residue 229 type catalytic sequence E description 136 source MCSA : MCSA1 22) chain A residue 232 type catalytic sequence H description 136 source MCSA : MCSA1 23) chain A residue 283-302 type prosite sequence SAVAQRLGVYTAKDYADILE description FATTY_ACID_DESATUR_2 Fatty acid desaturases family 2 signature. SAvaqRLgvytakDYadILE source prosite : PS00574 24) chain A residue 105 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 143 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 146 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 196 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 229 type BINDING sequence E description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 232 type BINDING sequence H description BINDING => ECO:0000269|PubMed:12704186, ECO:0000269|PubMed:17088542, ECO:0000269|PubMed:8861937 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links