eF-site ID 1ooh-AB PDB Code 1ooh Chain A, B click to enlarge Title Complex of Drosophila odorant binding protein LUSH with butanol Classification TRANSPORT PROTEIN Compound odorant binding protein LUSH Source null (OB76A_DROME) Sequence A:  SHMTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNF PPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVP PEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENAD GQFMWP B:  SHMTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNF PPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVP PEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENAD GQFMWP Description Functional site 1) chain A residue 100 type sequence K description BINDING SITE FOR RESIDUE ACT B 403 source : AC1 2) chain B residue 2 type sequence T description BINDING SITE FOR RESIDUE ACT B 403 source : AC1 3) chain B residue 3 type sequence M description BINDING SITE FOR RESIDUE ACT B 403 source : AC1 4) chain B residue 80 type sequence E description BINDING SITE FOR RESIDUE ACT B 403 source : AC1 5) chain B residue 100 type sequence K description BINDING SITE FOR RESIDUE ACT B 403 source : AC1 6) chain A residue 2 type sequence T description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 7) chain A residue 3 type sequence M description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 8) chain A residue 80 type sequence E description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 9) chain A residue 100 type sequence K description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 10) chain B residue 100 type sequence K description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 11) chain A residue 77 type sequence V description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 12) chain A residue 81 type sequence M description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 13) chain A residue 85 type sequence S description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 14) chain A residue 121 type sequence F description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 15) chain A residue 122 type sequence M description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 16) chain B residue 77 type sequence V description BINDING SITE FOR RESIDUE ACT B 406 source : AC4 17) chain B residue 81 type sequence M description BINDING SITE FOR RESIDUE ACT B 406 source : AC4 18) chain B residue 85 type sequence S description BINDING SITE FOR RESIDUE ACT B 406 source : AC4 19) chain B residue 121 type sequence F description BINDING SITE FOR RESIDUE ACT B 406 source : AC4 20) chain B residue 122 type sequence M description BINDING SITE FOR RESIDUE ACT B 406 source : AC4 21) chain A residue 52 type sequence S description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 22) chain A residue 55 type sequence A description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 23) chain A residue 57 type sequence T description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 24) chain A residue 113 type sequence F description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 25) chain B residue 52 type sequence S description BINDING SITE FOR RESIDUE 1BO B 601 source : AC6 26) chain B residue 55 type sequence A description BINDING SITE FOR RESIDUE 1BO B 601 source : AC6 27) chain B residue 57 type sequence T description BINDING SITE FOR RESIDUE 1BO B 601 source : AC6 28) chain B residue 113 type sequence F description BINDING SITE FOR RESIDUE 1BO B 601 source : AC6 29) chain B residue 123 type sequence W description BINDING SITE FOR RESIDUE 1BO B 601 source : AC6 30) chain A residue 52 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12881720, ECO:0007744|PDB:1OOF source Swiss-Prot : SWS_FT_FI1 31) chain A residue 57 type BINDING sequence T description BINDING => ECO:0000269|PubMed:12881720, ECO:0007744|PDB:1OOF source Swiss-Prot : SWS_FT_FI1 32) chain B residue 52 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12881720, ECO:0007744|PDB:1OOF source Swiss-Prot : SWS_FT_FI1 33) chain B residue 57 type BINDING sequence T description BINDING => ECO:0000269|PubMed:12881720, ECO:0007744|PDB:1OOF source Swiss-Prot : SWS_FT_FI1

Display surface Download Links