eF-site ID 1ooh-A PDB Code 1ooh Chain A click to enlarge Title Complex of Drosophila odorant binding protein LUSH with butanol Classification TRANSPORT PROTEIN Compound odorant binding protein LUSH Source Drosophila melanogaster (Fruit fly) (OB76A_DROME) Sequence A:  SHMTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNF PPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVP PEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENAD GQFMWP Description Functional site 1) chain A residue 100 type sequence K description BINDING SITE FOR RESIDUE ACT B 403 source : AC1 2) chain A residue 2 type sequence T description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 3) chain A residue 3 type sequence M description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 4) chain A residue 80 type sequence E description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 5) chain A residue 100 type sequence K description BINDING SITE FOR RESIDUE ACT A 404 source : AC2 6) chain A residue 77 type sequence V description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 7) chain A residue 81 type sequence M description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 8) chain A residue 85 type sequence S description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 9) chain A residue 121 type sequence F description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 10) chain A residue 122 type sequence M description BINDING SITE FOR RESIDUE ACT A 405 source : AC3 11) chain A residue 52 type sequence S description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 12) chain A residue 55 type sequence A description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 13) chain A residue 57 type sequence T description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 14) chain A residue 113 type sequence F description BINDING SITE FOR RESIDUE 1BO A 600 source : AC5 15) chain A residue 52 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12881720, ECO:0007744|PDB:1OOF source Swiss-Prot : SWS_FT_FI1 16) chain A residue 57 type BINDING sequence T description BINDING => ECO:0000269|PubMed:12881720, ECO:0007744|PDB:1OOF source Swiss-Prot : SWS_FT_FI1

Display surface Download Links