eF-site ID 1oo5-A PDB Code 1oo5 Chain A click to enlarge Title Studies on the Nitroreductase Prodrug-Activating System. Crystal Structures of the Enzyme Active Form and Complexes with the Inhibitor Dicoumarol and Dinitrobenzamide Prodrugs Classification OXIDOREDUCTASE Compound Oxygen-insensitive NAD(P)H nitroreductase Source Escherichia coli (strain K12) (NFNB_ECOLI) Sequence A:  MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSS TNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASH VVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKG RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLD AVPIEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFN ATLPKSRLPQNITLTEV Description Functional site 1) chain A residue 10 type sequence R description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 2) chain A residue 11 type sequence H description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 3) chain A residue 12 type sequence S description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 4) chain A residue 14 type sequence K description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 5) chain A residue 71 type sequence N description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 6) chain A residue 74 type sequence K description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 7) chain A residue 163 type sequence P description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 8) chain A residue 164 type sequence I description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 9) chain A residue 165 type sequence E description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 10) chain A residue 166 type sequence G description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 11) chain A residue 205 type sequence K description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 12) chain A residue 207 type sequence R description BINDING SITE FOR RESIDUE FMN A 218 source : AC1 13) chain A residue 38 type sequence P description BINDING SITE FOR RESIDUE FMN B 219 source : AC2 14) chain A residue 39 type sequence S description BINDING SITE FOR RESIDUE FMN B 219 source : AC2 15) chain A residue 40 type sequence S description BINDING SITE FOR RESIDUE FMN B 219 source : AC2 16) chain A residue 42 type sequence N description BINDING SITE FOR RESIDUE FMN B 219 source : AC2 17) chain A residue 142 type sequence Q description BINDING SITE FOR RESIDUE FMN B 219 source : AC2 18) chain A residue 145 type sequence L description BINDING SITE FOR RESIDUE FMN B 219 source : AC2 19) chain A residue 14 type catalytic sequence K description 211 source MCSA : MCSA1 20) chain A residue 74 type catalytic sequence K description 211 source MCSA : MCSA1 21) chain A residue 165 type catalytic sequence E description 211 source MCSA : MCSA1 22) chain A residue 10 type BINDING sequence R description BINDING => ECO:0000269|PubMed:11020276, ECO:0000269|PubMed:11491290, ECO:0000269|PubMed:15684426 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 165 type BINDING sequence E description BINDING => ECO:0000269|PubMed:11020276, ECO:0000269|PubMed:11491290, ECO:0000269|PubMed:15684426 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 205 type BINDING sequence K description BINDING => ECO:0000269|PubMed:11020276, ECO:0000269|PubMed:11491290, ECO:0000269|PubMed:15684426 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 14 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:Q01234 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 41 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:Q01234 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 71 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:Q01234 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 74 type BINDING sequence K description BINDING => ECO:0000250|UniProtKB:Q01234 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 107 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:Q01234 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links