eF-site ID 1ol7-A PDB Code 1ol7 Chain A click to enlarge Title Structure of Human Aurora-A 122-403 phosphorylated on Thr287, Thr288 Classification KINASE Compound SERINE/THREONINE KINASE 6 Source null (STK6_HUMAN) Sequence A:  QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFK AQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRV YLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSY CHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRR XXLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGK PPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKH NPSQRPMLREVLEHPWITANSSKP Description (1)  SERINE/THREONINE KINASE 6 (E.C.2.7.1.37) Functional site 1) chain A residue 261 type sequence N description BINDING SITE FOR RESIDUE MG A1392 source : AC1 2) chain A residue 274 type sequence D description BINDING SITE FOR RESIDUE MG A1392 source : AC1 3) chain A residue 274 type sequence D description BINDING SITE FOR RESIDUE MG A1393 source : AC2 4) chain A residue 139 type sequence L description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 5) chain A residue 140 type sequence G description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 6) chain A residue 141 type sequence K description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 7) chain A residue 142 type sequence G description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 8) chain A residue 143 type sequence K description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 9) chain A residue 147 type sequence V description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 10) chain A residue 160 type sequence A description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 11) chain A residue 162 type sequence K description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 12) chain A residue 211 type sequence E description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 13) chain A residue 217 type sequence T description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 14) chain A residue 260 type sequence E description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 15) chain A residue 261 type sequence N description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 16) chain A residue 274 type sequence D description BINDING SITE FOR RESIDUE ADP A 531 source : AC3 17) chain A residue 256 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10027, ECO:0000269|PubMed:14580337 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 162 type BINDING sequence K description BINDING => ECO:0000269|PubMed:27837025, ECO:0007744|PDB:5G1X source Swiss-Prot : SWS_FT_FI2 19) chain A residue 211 type BINDING sequence E description BINDING => ECO:0000269|PubMed:27837025, ECO:0007744|PDB:5G1X source Swiss-Prot : SWS_FT_FI2 20) chain A residue 260 type BINDING sequence E description BINDING => ECO:0000269|PubMed:27837025, ECO:0007744|PDB:5G1X source Swiss-Prot : SWS_FT_FI2 21) chain A residue 274 type BINDING sequence D description BINDING => ECO:0000269|PubMed:27837025, ECO:0007744|PDB:5G1X source Swiss-Prot : SWS_FT_FI2 22) chain A residue 143 type BINDING sequence K description BINDING => ECO:0000269|PubMed:27837025, ECO:0007744|PDB:5G1X source Swiss-Prot : SWS_FT_FI2 23) chain A residue 287 type MOD_RES sequence X description Phosphothreonine => ECO:0000269|PubMed:14580337, ECO:0000269|PubMed:19668197 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 288 type MOD_RES sequence X description Phosphothreonine => ECO:0000269|PubMed:11039908, ECO:0000269|PubMed:13678582, ECO:0000269|PubMed:14580337, ECO:0000269|PubMed:16246726, ECO:0000269|PubMed:18662907, ECO:0000269|PubMed:19668197, ECO:0000269|PubMed:26246606 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 342 type MOD_RES sequence S description Phosphoserine; by PKA and PAK => ECO:0000269|PubMed:16246726 source Swiss-Prot : SWS_FT_FI5 26) chain A residue 139-162 type prosite sequence LGKGKFGNVYLAREKQSKFILALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGKGKFGNVYlArekqskfi..........LALK source prosite : PS00107 27) chain A residue 252-264 type prosite sequence VIHRDIKPENLLL description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. ViHrDIKpeNLLL source prosite : PS00108 28) chain A residue 258 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links