eF-site ID 1okv-D
PDB Code 1okv
Chain D

click to enlarge
Title Cyclin A binding groove inhibitor H-Arg-Arg-Leu-Ile-Phe-NH2
Classification TRANSFERASE/TRANSFERASE INHIBITOR
Compound CELL DIVISION PROTEIN KINASE 2
Source Homo sapiens (Human) (1OKV)
Sequence D:  NEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRA
ILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGK
LQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVL
RMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESL
AMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSW
PESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREK
YKNSKYHGVSLLNPPETLNL
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A2, H-ARG-ARG-LEU-ILE-PHE-NH2


Functional site

1) chain D
residue 210
type
ligand
sequence M
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2

2) chain D
residue 217
type
ligand
sequence W
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2

3) chain D
residue 220
type
ligand
sequence E
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2

4) chain D
residue 250
type
ligand
sequence R
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2

5) chain D
residue 254
type
ligand
sequence Q
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2

6) chain D
residue 281
type
ligand
sequence I
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2

7) chain D
residue 283
type
ligand
sequence D
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2

8) chain D
residue 285
type
ligand
sequence T
description BINDING SITE FOR CHAIN F OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC2


Display surface

Download
Links