eF-site ID 1okv-B
PDB Code 1okv
Chain B

click to enlarge
Title Cyclin A binding groove inhibitor H-Arg-Arg-Leu-Ile-Phe-NH2
Classification TRANSFERASE/TRANSFERASE INHIBITOR
Compound CELL DIVISION PROTEIN KINASE 2
Source Homo sapiens (Human) (1OKV)
Sequence B:  VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAIL
VDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRM
EHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE
SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNL
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A2, H-ARG-ARG-LEU-ILE-PHE-NH2


Functional site

1) chain B
residue 210
type
ligand
sequence M
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

2) chain B
residue 217
type
ligand
sequence W
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

3) chain B
residue 220
type
ligand
sequence E
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

4) chain B
residue 250
type
ligand
sequence R
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

5) chain B
residue 253
type
ligand
sequence L
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

6) chain B
residue 254
type
ligand
sequence Q
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

7) chain B
residue 281
type
ligand
sequence I
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

8) chain B
residue 282
type
ligand
sequence T
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

9) chain B
residue 283
type
ligand
sequence D
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1

10) chain B
residue 285
type
ligand
sequence T
description BINDING SITE FOR CHAIN E OF H-ARG-ARG-LEU-ILE-PHE-NH2
source : AC1


Display surface

Download
Links