eF-site ID 1oiy-D
PDB Code 1oiy
Chain D

click to enlarge
Title Structure of human Thr160-phospho CDK2/cyclin A complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
Classification KINASE
Compound CELL DIVISION PROTEIN KINASE 2
Source Homo sapiens (Human) (CGA2_HUMAN)
Sequence D:  VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAIL
VDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRM
EHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE
SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNL
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A2


Functional site

1) chain D
residue 189
type
ligand
sequence M
description BINDING SITE FOR RESIDUE SGM D1193
source : AC5

2) chain D
residue 193
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SGM D1193
source : AC5

3) chain D
residue 241
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SGM D1193
source : AC5

4) chain D
residue 305
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SGM D1193
source : AC5

5) chain D
residue 211-242
type prosite
ligand
sequence RAILVDWLVEVGEEYKLQNETLHLAVNYIDRF
description Cyclins signature. R-x(2)-[LIVMSA]-x(2)-[FYWS]-[LIVM]-x(8)-[LIVMFC]-x(4)-[LIVMFYA]-x(2)
source prosite : PS00292

6) chain D
residue 189
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence M
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiy_D_1193

7) chain D
residue 192-193
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence KC
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiy_D_1193

8) chain D
residue 237
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence N
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiy_D_1193

9) chain D
residue 241
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence R
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiy_D_1193

10) chain D
residue 305
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence D
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiy_D_1193

11) chain D
residue 308
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence A
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiy_D_1193


Display surface

Download
Links