eF-site ID 1oiy-A PDB Code 1oiy Chain A click to enlarge Title Structure of human Thr160-phospho CDK2/cyclin A complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor Classification KINASE Compound CELL DIVISION PROTEIN KINASE 2 Source Homo sapiens (Human) (CGA2_HUMAN) Sequence A:  SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLTE GVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEF LHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYXHE VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRAL FPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPK WARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALA HPFFQDVTKPVPHL Description Functional site 1) chain A residue 10 type sequence I description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 2) chain A residue 12 type sequence E description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 3) chain A residue 18 type sequence V description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 4) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 5) chain A residue 64 type sequence V description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 6) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 7) chain A residue 81 type sequence E description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 8) chain A residue 83 type sequence L description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 9) chain A residue 84 type sequence H description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 10) chain A residue 86 type sequence D description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 11) chain A residue 89 type sequence K description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 12) chain A residue 131 type sequence Q description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 13) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 14) chain A residue 134 type sequence L description BINDING SITE FOR RESIDUE N41 A1298 source : AC2 15) chain A residue 131 type catalytic sequence Q description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 16) chain A residue 127 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA1 17) chain A residue 127 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 18) chain A residue 129 type catalytic sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA3 19) chain A residue 127 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA5 20) chain A residue 129 type catalytic sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA5 21) chain A residue 165 type catalytic sequence T description Annotated By Reference To The Literature 1ir3 source CSA : CSA5 22) chain A residue 127 type catalytic sequence D description Annotated By Reference To The Literature 1ir3 source CSA : CSA7 23) chain A residue 129 type catalytic sequence K description Annotated By Reference To The Literature 1ir3 source CSA : CSA7 24) chain A residue 132 type catalytic sequence N description Annotated By Reference To The Literature 1ir3 source CSA : CSA7 25) chain A residue 10-33 type prosite sequence IGEGTYGVVYKARNKLTGEVVALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGEGTYGVVYkArnkltgev..........VALK source prosite : PS00107 26) chain A residue 123-135 type prosite sequence VLHRDLKPQNLLI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. VlHrDLKpqNLLI source prosite : PS00108 27) chain A residue 149 type catalytic sequence A description Mapped from 2phk to 1oiy using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1 28) chain A residue 151 type catalytic sequence A description Mapped from 2phk to 1oiy using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892 source extCATRES : extCATRES1

Display surface Download Links