eF-site ID 1oiy-A
PDB Code 1oiy
Chain A

click to enlarge
Title Structure of human Thr160-phospho CDK2/cyclin A complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
Classification KINASE
Compound CELL DIVISION PROTEIN KINASE 2
Source Homo sapiens (Human) (CGA2_HUMAN)
Sequence A:  SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLTE
GVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEF
LHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHR
VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYXHE
VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRAL
FPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPK
WARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALA
HPFFQDVTKPVPHL
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A2


Functional site

1) chain A
residue 10
type
ligand
sequence I
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

2) chain A
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

3) chain A
residue 18
type
ligand
sequence V
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

4) chain A
residue 31
type
ligand
sequence A
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

5) chain A
residue 64
type
ligand
sequence V
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

6) chain A
residue 80
type
ligand
sequence F
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

7) chain A
residue 81
type
ligand
sequence E
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

8) chain A
residue 83
type
ligand
sequence L
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

9) chain A
residue 84
type
ligand
sequence H
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

10) chain A
residue 86
type
ligand
sequence D
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

11) chain A
residue 89
type
ligand
sequence K
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

12) chain A
residue 131
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

13) chain A
residue 132
type
ligand
sequence N
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

14) chain A
residue 134
type
ligand
sequence L
description BINDING SITE FOR RESIDUE N41 A1298
source : AC2

15) chain A
residue 131
type ACT_SITE
ligand
sequence Q
description Proton acceptor.
source Swiss-Prot : SWS_FT_FI1

16) chain A
residue 37
type BINDING
ligand
sequence L
description ATP.
source Swiss-Prot : SWS_FT_FI2

17) chain A
residue 90
type BINDING
ligand
sequence F
description ATP.
source Swiss-Prot : SWS_FT_FI2

18) chain A
residue 149
type BINDING
ligand
sequence A
description ATP.
source Swiss-Prot : SWS_FT_FI2

19) chain A
residue 14-22
type NP_BIND
ligand
sequence TYGVVYKAR
description ATP.
source Swiss-Prot : SWS_FT_FI3

20) chain A
residue 85-87
type NP_BIND
ligand
sequence QDL
description ATP.
source Swiss-Prot : SWS_FT_FI3

21) chain A
residue 133-136
type NP_BIND
ligand
sequence LLIN
description ATP.
source Swiss-Prot : SWS_FT_FI3

22) chain A
residue 149
type catalytic
ligand
sequence A
description Mapped from 2phk to 1oiy using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

23) chain A
residue 151
type catalytic
ligand
sequence A
description Mapped from 2phk to 1oiy using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 98031892
source extCATRES : extCATRES1

24) chain A
residue 10-33
type prosite
ligand
sequence IGEGTYGVVYKARNKLTGEVVALK
description Protein kinases ATP-binding region signature.[LIV]-G-{P}-G-{P}-[FYWMGSTNH]-[SGA]-{PW}-[LIVCAT]-{PD}-x-[GSTACLIVMFY]-x(5,18)-[LIVMFYWCSTAR]-[AIVP]-[LIVMFAGCKR]-K.
source prosite : PS00107

25) chain A
residue 123-135
type prosite
ligand
sequence VLHRDLKPQNLLI
description Serine/Threonine protein kinases active-site signature.[LIVMFYC]-x-[HY]-x-D-[LIVMFY]-K-x(2)-N-[LIVMFYCT](3).
source prosite : PS00108

26) chain A
residue 131
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

27) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA1

28) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

29) chain A
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA3

30) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA5

31) chain A
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA5

32) chain A
residue 165
type catalytic
ligand
sequence T
description Annotated By Reference To The Literature 1ir3
source CSA : CSA5

33) chain A
residue 127
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ir3
source CSA : CSA7

34) chain A
residue 129
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ir3
source CSA : CSA7

35) chain A
residue 132
type catalytic
ligand
sequence N
description Annotated By Reference To The Literature 1ir3
source CSA : CSA7


Display surface

Download
Links