eF-site ID 1oiu-B
PDB Code 1oiu
Chain B

click to enlarge
Title Structure of human Thr160-phospho CDK2/cyclin A complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
Classification KINASE
Compound CELL DIVISION PROTEIN KINASE 2
Source Homo sapiens (Human) (CGA2_HUMAN)
Sequence B:  DYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVD
WLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLV
GTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEH
LVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFL
GELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESL
IRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNS
KYHGVSLLNPPETLNL
Description (1)  CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A2


Functional site

1) chain B
residue 200
type
ligand
sequence M
description BINDING SITE FOR RESIDUE MG B1433
source : AC1

2) chain B
residue 203
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE MG B1433
source : AC1

3) chain B
residue 206
type
ligand
sequence I
description BINDING SITE FOR RESIDUE MG B1433
source : AC1

4) chain B
residue 189
type
ligand
sequence M
description BINDING SITE FOR RESIDUE SGM B1193
source : AC4

5) chain B
residue 192
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SGM B1193
source : AC4

6) chain B
residue 193
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SGM B1193
source : AC4

7) chain B
residue 241
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SGM B1193
source : AC4

8) chain B
residue 305
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SGM B1193
source : AC4

9) chain B
residue 211-242
type prosite
ligand
sequence RAILVDWLVEVGEEYKLQNETLHLAVNYIDRF
description Cyclins signature. R-x(2)-[LIVMSA]-x(2)-[FYWS]-[LIVM]-x(8)-[LIVMFC]-x(4)-[LIVMFYA]-x(2)
source prosite : PS00292

10) chain B
residue 189
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence M
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiu_B_1193

11) chain B
residue 192-193
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence KC
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiu_B_1193

12) chain B
residue 241
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence R
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiu_B_1193

13) chain B
residue 305
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence D
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiu_B_1193

14) chain B
residue 308
type binding
ligand SGM: MONOTHIOGLYCEROL
sequence A
description MONOTHIOGLYCEROL binding site
source pdb_hetatom : SGM_1oiu_B_1193


Display surface

Download
Links