eF-site ID 1oal-A PDB Code 1oal Chain A click to enlarge Title Active site copper and zinc ions modulate the quaternary structure of prokaryotic Cu,Zn superoxide dismutase Classification OXIDOREDUCTASE Compound SUPEROXIDE DISMUTASE Source (SODC_PHOLE) Sequence A:  QDLTVKMTDLQTGKPVGTIELSQNKYGVVFIPELADLTPG EHGFHIHQNGSCASSEKDGKVVLGGAAGGHYDPEHTNKHG FPWTDDNHKGDLPALFVSANGLATNPVLAPRLTLKELKGH AIMIHAGGDNHSDMPKALGGGGARVACGVIQ Description (1)  SUPEROXIDE DISMUTASE (E.C.1.15.1.1) Functional site 1) chain A residue 70 type sequence H description BINDING SITE FOR RESIDUE ZN A 152 source : AC1 2) chain A residue 79 type sequence H description BINDING SITE FOR RESIDUE ZN A 152 source : AC1 3) chain A residue 88 type sequence H description BINDING SITE FOR RESIDUE ZN A 152 source : AC1 4) chain A residue 91 type sequence D description BINDING SITE FOR RESIDUE ZN A 152 source : AC1 5) chain A residue 45 type sequence H description BINDING SITE FOR RESIDUE CU A 153 source : AC2 6) chain A residue 47 type sequence H description BINDING SITE FOR RESIDUE CU A 153 source : AC2 7) chain A residue 70 type sequence H description BINDING SITE FOR RESIDUE CU A 153 source : AC2 8) chain A residue 125 type sequence H description BINDING SITE FOR RESIDUE CU A 153 source : AC2 9) chain A residue 43-53 type prosite sequence GFHIHQNGSCA description SOD_CU_ZN_1 Copper/Zinc superoxide dismutase signature 1. GFHIHQnGScA source prosite : PS00087 10) chain A residue 139-150 type prosite sequence GGGGARVACGVI description SOD_CU_ZN_2 Copper/Zinc superoxide dismutase signature 2. GGGGaRvACgvI source prosite : PS00332 11) chain A residue 45 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 47 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 70 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 14) chain A residue 79 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 15) chain A residue 88 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 91 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 125 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links