eF-site ID 1o9s-ABKL PDB Code 1o9s Chain A, B, K, L click to enlarge Title Crystal structure of a ternary complex of the human histone methyltransferase SET7/9 Classification TRANSFERASE Compound HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-4 SPECIFIC Source Homo sapiens (Human) (Q16776) Sequence A:  GVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALY GKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKS TSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAV GPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVID VPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPI KCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVE LKAFQATQQK B:  GVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALY GKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKS TSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAV GPNTVMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVID VPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPI KCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVE LKAFQATQQK K:  ARTXQTARKY L:  ARTXQT Description Functional site 1) chain A residue 226 type sequence A description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 2) chain A residue 228 type sequence E description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 3) chain A residue 265 type sequence N description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 4) chain A residue 293 type sequence H description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 5) chain A residue 294 type sequence K description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 6) chain A residue 296 type sequence N description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 7) chain A residue 297 type sequence H description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 8) chain A residue 335 type sequence Y description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 9) chain A residue 352 type sequence W description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 10) chain A residue 356 type sequence E description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 11) chain K residue 4 type sequence X description BINDING SITE FOR RESIDUE SAH A1367 source : AC1 12) chain B residue 226 type sequence A description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 13) chain B residue 228 type sequence E description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 14) chain B residue 265 type sequence N description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 15) chain B residue 293 type sequence H description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 16) chain B residue 294 type sequence K description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 17) chain B residue 296 type sequence N description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 18) chain B residue 297 type sequence H description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 19) chain B residue 335 type sequence Y description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 20) chain B residue 352 type sequence W description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 21) chain B residue 356 type sequence E description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 22) chain L residue 4 type sequence X description BINDING SITE FOR RESIDUE SAH B1367 source : AC2 23) chain A residue 245 type catalytic sequence Y description 350 source MCSA : MCSA1 24) chain A residue 293 type catalytic sequence H description 350 source MCSA : MCSA1 25) chain A residue 297 type catalytic sequence H description 350 source MCSA : MCSA1 26) chain A residue 305 type catalytic sequence Y description 350 source MCSA : MCSA1 27) chain A residue 335 type catalytic sequence Y description 350 source MCSA : MCSA1 28) chain B residue 245 type catalytic sequence Y description 350 source MCSA : MCSA2 29) chain B residue 293 type catalytic sequence H description 350 source MCSA : MCSA2 30) chain B residue 297 type catalytic sequence H description 350 source MCSA : MCSA2 31) chain B residue 305 type catalytic sequence Y description 350 source MCSA : MCSA2 32) chain B residue 335 type catalytic sequence Y description 350 source MCSA : MCSA2 33) chain K residue 2 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 34) chain L residue 2 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 297 type MOD_RES sequence H description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 36) chain B residue 226 type MOD_RES sequence A description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 37) chain B residue 296 type MOD_RES sequence N description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 38) chain B residue 297 type MOD_RES sequence H description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 39) chain K residue 3 type MOD_RES sequence T description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 40) chain L residue 3 type MOD_RES sequence T description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 41) chain K residue 4 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 42) chain B residue 335 type MOD_RES sequence Y description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 43) chain L residue 4 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 44) chain A residue 266 type MOD_RES sequence T description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 45) chain A residue 317 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 46) chain A residue 335 type MOD_RES sequence Y description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 47) chain B residue 245 type MOD_RES sequence Y description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 48) chain B residue 256 type MOD_RES sequence D description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 49) chain B residue 266 type MOD_RES sequence T description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 50) chain B residue 317 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 51) chain K residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 52) chain L residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 53) chain K residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 54) chain L residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 55) chain K residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P68433 source Swiss-Prot : SWS_FT_FI6 56) chain K residue 9 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 57) chain K residue 10 type MOD_RES sequence Y description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16457588 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links