eF-site ID 1o98-A PDB Code 1o98 Chain A click to enlarge Title 1.4A CRYSTAL STRUCTURE OF PHOSPHOGLYCERATE MUTASE FROM BACILLUS STEAROTHERMOPHILUS COMPLEXED WITH 2-PHOSPHOGLYCERATE Classification ISOMERASE Compound 2,3-BISPHOSPHOGLYCERATE-INDEPENDENT PHOSPHOGLYCERATE MUTASE Source Geobacillus stearothermophilus (Bacillus stearothermophilus) (Q9X519) Sequence A:  SKKPVALIILDGFALRDETYGNAVAQANKPNFDRYWNEYP HTTLKACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTR INIAIREGEFDRNETFLAAMNHVKQHGTSLHLFGLLSDGG VHSHIHHLYALLRLAAKEGVKRVYIHGFLDGRDVGPQTAP QYIKELQEKIKEYGVGEIATLSGRYYSMDRDKRWDRVEKA YRAMVYGEGPTYRDPLECIEDSYKHGIYDEFVLPSVIVRE DGRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFREFD RGPKHPKHLFFVCLTHFSETVAGYVAFKPTNLDNTIGEVL SQHGLRQLRIAETEKYPHVTFFMSGGREEEFPGEDRILIN SPKVPTYDLKPEMSAYEVTDALLKEIEADKYDAIILNYAN PDMVGHSGKLEPTIKAVEAVDECLGKVVDAILAKGGIAII TADHGNADEVLTPDGKPQTAHTTNPVPVIVTKKGIKLRDG GILGDLAPTMLDLLGLPQPKEMTGKSLIV Description Functional site 1) chain A residue 403 type sequence D description BINDING SITE FOR RESIDUE MN A 601 source : AC1 2) chain A residue 407 type sequence H description BINDING SITE FOR RESIDUE MN A 601 source : AC1 3) chain A residue 462 type sequence H description BINDING SITE FOR RESIDUE MN A 601 source : AC1 4) chain A residue 12 type sequence D description BINDING SITE FOR RESIDUE MN A 701 source : AC2 5) chain A residue 62 type sequence S description BINDING SITE FOR RESIDUE MN A 701 source : AC2 6) chain A residue 444 type sequence D description BINDING SITE FOR RESIDUE MN A 701 source : AC2 7) chain A residue 445 type sequence H description BINDING SITE FOR RESIDUE MN A 701 source : AC2 8) chain A residue 297 type sequence H description BINDING SITE FOR RESIDUE SO4 A 901 source : AC3 9) chain A residue 299 type sequence S description BINDING SITE FOR RESIDUE SO4 A 901 source : AC3 10) chain A residue 300 type sequence E description BINDING SITE FOR RESIDUE SO4 A 901 source : AC3 11) chain A residue 342 type sequence F description BINDING SITE FOR RESIDUE SO4 A 901 source : AC3 12) chain A residue 349 type sequence E description BINDING SITE FOR RESIDUE SO4 A 901 source : AC3 13) chain A residue 194 type sequence R description BINDING SITE FOR RESIDUE SO4 A 902 source : AC4 14) chain A residue 196 type sequence D description BINDING SITE FOR RESIDUE SO4 A 902 source : AC4 15) chain A residue 197 type sequence R description BINDING SITE FOR RESIDUE SO4 A 902 source : AC4 16) chain A residue 17 type sequence R description BINDING SITE FOR RESIDUE SO4 A 903 source : AC5 17) chain A residue 337 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 904 source : AC6 18) chain A residue 351 type sequence E description BINDING SITE FOR RESIDUE SO4 A 904 source : AC6 19) chain A residue 357 type sequence R description BINDING SITE FOR RESIDUE SO4 A 904 source : AC6 20) chain A residue 134 type sequence R description BINDING SITE FOR RESIDUE SO4 A 905 source : AC7 21) chain A residue 170 type sequence K description BINDING SITE FOR RESIDUE SO4 A 905 source : AC7 22) chain A residue 174 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 905 source : AC7 23) chain A residue 200 type sequence K description BINDING SITE FOR RESIDUE SO4 A 906 source : AC8 24) chain A residue 203 type sequence R description BINDING SITE FOR RESIDUE SO4 A 906 source : AC8 25) chain A residue 207 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 906 source : AC8 26) chain A residue 283 type sequence G description BINDING SITE FOR RESIDUE SO4 A 906 source : AC8 27) chain A residue 284 type sequence P description BINDING SITE FOR RESIDUE SO4 A 906 source : AC8 28) chain A residue 61 type sequence N description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 29) chain A residue 62 type sequence S description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 30) chain A residue 123 type sequence H description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 31) chain A residue 153 type sequence R description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 32) chain A residue 154 type sequence D description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 33) chain A residue 185 type sequence R description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 34) chain A residue 191 type sequence R description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 35) chain A residue 261 type sequence R description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 36) chain A residue 264 type sequence R description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 37) chain A residue 336 type sequence K description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 38) chain A residue 403 type sequence D description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 39) chain A residue 407 type sequence H description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 40) chain A residue 462 type sequence H description BINDING SITE FOR RESIDUE 2PG A 801 source : AC9 41) chain A residue 12 type catalytic sequence D description 738 source MCSA : MCSA1 42) chain A residue 462 type catalytic sequence H description 738 source MCSA : MCSA1 43) chain A residue 62 type catalytic sequence S description 738 source MCSA : MCSA1 44) chain A residue 154 type catalytic sequence D description 738 source MCSA : MCSA1 45) chain A residue 261 type catalytic sequence R description 738 source MCSA : MCSA1 46) chain A residue 336 type catalytic sequence K description 738 source MCSA : MCSA1 47) chain A residue 403 type catalytic sequence D description 738 source MCSA : MCSA1 48) chain A residue 407 type catalytic sequence H description 738 source MCSA : MCSA1 49) chain A residue 444 type catalytic sequence D description 738 source MCSA : MCSA1 50) chain A residue 445 type catalytic sequence H description 738 source MCSA : MCSA1 51) chain A residue 62 type ACT_SITE sequence S description Phosphoserine intermediate => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI1 52) chain A residue 12 type BINDING sequence D description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795 source Swiss-Prot : SWS_FT_FI2 53) chain A residue 62 type BINDING sequence S description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795 source Swiss-Prot : SWS_FT_FI2 54) chain A residue 191 type BINDING sequence R description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795 source Swiss-Prot : SWS_FT_FI2 55) chain A residue 444 type BINDING sequence D description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795 source Swiss-Prot : SWS_FT_FI2 56) chain A residue 445 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795 source Swiss-Prot : SWS_FT_FI2 57) chain A residue 123 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI3 58) chain A residue 153 type BINDING sequence R description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI3 59) chain A residue 185 type BINDING sequence R description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI3 60) chain A residue 261 type BINDING sequence R description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI3 61) chain A residue 403 type BINDING sequence D description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI3 62) chain A residue 407 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI3 63) chain A residue 462 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:10764795, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI3 64) chain A residue 36 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000255|HAMAP-Rule:MF_01038 source Swiss-Prot : SWS_FT_FI5 65) chain A residue 336 type BINDING sequence K description BINDING => ECO:0000269|PubMed:10747010, ECO:0000269|PubMed:12729763 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links