eF-site ID 1o3t-A PDB Code 1o3t Chain A click to enlarge Title PROTEIN-DNA RECOGNITION AND DNA DEFORMATION REVEALED IN CRYSTAL STRUCTURES OF CAP-DNA COMPLEXES Classification GENE REGULATION/DNA Compound 5'-D(*GP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3' Source Escherichia coli (strain K12) (1O3T) Sequence A:  PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVA VLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRA KTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTS EKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKIT RQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG Description Functional site 1) chain A residue 124 type sequence L description BINDING SITE FOR RESIDUE CMP B 761 source : AC1 2) chain A residue 128 type sequence S description BINDING SITE FOR RESIDUE CMP B 761 source : AC1 3) chain A residue 49 type sequence V description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 4) chain A residue 61 type sequence L description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 5) chain A residue 70 type sequence I description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 6) chain A residue 71 type sequence G description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 7) chain A residue 72 type sequence E description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 8) chain A residue 73 type sequence L description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 9) chain A residue 82 type sequence R description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 10) chain A residue 83 type sequence S description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 11) chain A residue 84 type sequence A description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 12) chain A residue 127 type sequence T description BINDING SITE FOR RESIDUE CMP A 762 source : AC2 13) chain A residue 167-190 type prosite sequence ITRQEIGQIVGCSRETVGRILKML description HTH_CRP_1 Crp-type HTH domain signature. ITRqeIGqIVGcSreTv.GRiLkmL source prosite : PS00042 14) chain A residue 29-45 type prosite sequence LIHQGEKAETLYYIVKG description CNMP_BINDING_1 Cyclic nucleotide-binding domain signature 1. LIhQGEkAEtLYYIvkG source prosite : PS00888 15) chain A residue 70-88 type prosite sequence IGELGLFEEGQERSAWVRA description CNMP_BINDING_2 Cyclic nucleotide-binding domain signature 2. IGElGLfeegqe.....RSAwVrA source prosite : PS00889 16) chain A residue 179-185 type DNA_BIND sequence SRETVGR description H-T-H motif => ECO:0000255|PROSITE-ProRule:PRU00387 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 56 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11124031, ECO:0000269|PubMed:12202833, ECO:0000269|PubMed:1653449, ECO:0000269|PubMed:2828639, ECO:0000269|PubMed:6286624, ECO:0000269|PubMed:8757802 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 71 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11124031, ECO:0000269|PubMed:12202833, ECO:0000269|PubMed:1653449, ECO:0000269|PubMed:2828639, ECO:0000269|PubMed:6286624, ECO:0000269|PubMed:8757802 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 82 type BINDING sequence R description BINDING => ECO:0000269|PubMed:11124031, ECO:0000269|PubMed:12202833, ECO:0000269|PubMed:1653449, ECO:0000269|PubMed:2828639, ECO:0000269|PubMed:6286624, ECO:0000269|PubMed:8757802 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 127 type BINDING sequence T description BINDING => ECO:0000269|PubMed:11124031, ECO:0000269|PubMed:12202833, ECO:0000269|PubMed:1653449, ECO:0000269|PubMed:2828639, ECO:0000269|PubMed:6286624, ECO:0000269|PubMed:8757802 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 135 type BINDING sequence A description BINDING => ECO:0000269|PubMed:11124031, ECO:0000269|PubMed:12202833, ECO:0000269|PubMed:1653449, ECO:0000269|PubMed:2828639, ECO:0000269|PubMed:6286624, ECO:0000269|PubMed:8757802 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 170 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:11124031, ECO:0000269|PubMed:12202833, ECO:0000269|PubMed:1653449, ECO:0000269|PubMed:2828639, ECO:0000269|PubMed:6286624, ECO:0000269|PubMed:8757802 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 96 type SITE sequence E description Activating region 2 (AR2); probably contacts the N-terminus of RpoA => ECO:0000269|PubMed:8978616 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 101 type SITE sequence K description Activating region 2 (AR2); probably contacts the N-terminus of RpoA => ECO:0000269|PubMed:15520470, ECO:0000269|PubMed:8978616 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 100 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links