eF-site ID 1o1h-B
PDB Code 1o1h
Chain B

click to enlarge
Title STRUCTURE OF GLUCOSE ISOMERASE DERIVATIZED WITH KR.
Classification LIGASE
Compound Xylose isomerase
Source ORGANISM_SCIENTIFIC: Streptomyces rubiginosus;
Sequence B:  NYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVR
RLAELGAHGVTFHDDDLIPFGSSDSEREEHVKRFRQALDD
TGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIR
NIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEA
FDLLGEYVTSQGYDIRFAIEPKPNEPRGDILLPTVGHALA
FIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGKL
FHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYS
GPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKERAAAFR
ADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFD
VDAAAARGMAFERLDQLAMDHLLGAR
Description (1)  STRUCTURE OF GLUCOSE ISOMERASE DERIVATIZED WITH KR.


Functional site

1) chain B
residue 216
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CA B 1002
source : AC2

2) chain B
residue 219
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CA B 1002
source : AC2

3) chain B
residue 254
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA B 1002
source : AC2

4) chain B
residue 256
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA B 1002
source : AC2

5) chain B
residue 180
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG B 1004
source : AC4

6) chain B
residue 216
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG B 1004
source : AC4

7) chain B
residue 244
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG B 1004
source : AC4

8) chain B
residue 286
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG B 1004
source : AC4

9) chain B
residue 29
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL B 1009
source : AC5

10) chain B
residue 293
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CL B 1009
source : AC5

11) chain B
residue 265
type
ligand
sequence R
description BINDING SITE FOR RESIDUE CL B 1011
source : AC7

12) chain B
residue 268
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CL B 1011
source : AC7

13) chain B
residue 378
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL B 1011
source : AC7

14) chain B
residue 379
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL B 1011
source : AC7

15) chain B
residue 135
type
ligand
sequence A
description BINDING SITE FOR RESIDUE KR B 1005
source : AC9

16) chain B
residue 164
type
ligand
sequence L
description BINDING SITE FOR RESIDUE KR B 1005
source : AC9

17) chain B
residue 204
type
ligand
sequence R
description BINDING SITE FOR RESIDUE KR B 1007
source : BC2

18) chain B
residue 233
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE KR A 1008
source : BC3

19) chain B
residue 15
type
ligand
sequence W
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

20) chain B
residue 53
type
ligand
sequence H
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

21) chain B
residue 136
type
ligand
sequence W
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

22) chain B
residue 180
type
ligand
sequence E
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

23) chain B
residue 216
type
ligand
sequence E
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

24) chain B
residue 219
type
ligand
sequence H
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

25) chain B
residue 244
type
ligand
sequence D
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

26) chain B
residue 286
type
ligand
sequence D
description BINDING SITE FOR RESIDUE TRS B 1014
source : BC5

27) chain B
residue 15
type
ligand
sequence W
description BINDING SITE FOR RESIDUE MPD B 1016
source : BC7

28) chain B
residue 19
type
ligand
sequence W
description BINDING SITE FOR RESIDUE MPD B 1016
source : BC7

29) chain B
residue 53
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MPD B 1016
source : BC7

30) chain B
residue 56
type ACT_SITE
ligand
sequence D
description By similarity.
source Swiss-Prot : SWS_FT_FI5

31) chain B
residue 53
type ACT_SITE
ligand
sequence H
description
source Swiss-Prot : SWS_FT_FI6

32) chain B
residue 180
type METAL
ligand
sequence E
description Magnesium 1
source Swiss-Prot : SWS_FT_FI7

33) chain B
residue 216
type METAL
ligand
sequence E
description Magnesium 1
source Swiss-Prot : SWS_FT_FI7

34) chain B
residue 244
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI7

35) chain B
residue 286
type METAL
ligand
sequence D
description Magnesium 1
source Swiss-Prot : SWS_FT_FI7

36) chain B
residue 216
type METAL
ligand
sequence E
description Magnesium 2
source Swiss-Prot : SWS_FT_FI8

37) chain B
residue 219
type METAL
ligand
sequence H
description Magnesium 2
source Swiss-Prot : SWS_FT_FI8

38) chain B
residue 254
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI8

39) chain B
residue 256
type METAL
ligand
sequence D
description Magnesium 2
source Swiss-Prot : SWS_FT_FI8

40) chain B
residue 15
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence W
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1o1h_B_1016

41) chain B
residue 19
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence W
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1o1h_B_1016

42) chain B
residue 53
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence H
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1o1h_B_1016

43) chain B
residue 56
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence D
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1o1h_B_1016

44) chain B
residue 91
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence N
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1o1h_B_1016

45) chain B
residue 93-94
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence FT
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1o1h_B_1016

46) chain B
residue 288
type binding
ligand MPD: (4S)-2-METHYL-2,4-PENTANEDIOL
sequence K
description (4S)-2-METHYL-2,4-PENTANEDIOL binding site
source pdb_hetatom : MPD_1o1h_B_1016

47) chain B
residue 15
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence W
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

48) chain B
residue 53
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence H
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

49) chain B
residue 89-90
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence TT
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

50) chain B
residue 93
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence F
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

51) chain B
residue 134
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence V
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

52) chain B
residue 136
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence W
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

53) chain B
residue 180
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence E
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

54) chain B
residue 214
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence N
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

55) chain B
residue 216
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence E
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

56) chain B
residue 219
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence H
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

57) chain B
residue 244
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence D
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

58) chain B
residue 256
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence D
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

59) chain B
residue 286
type binding
ligand TRS: 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
sequence D
description 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL binding site
source pdb_hetatom : TRS_1o1h_B_1014

60) chain B
residue 254
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1de6
source CSA : CSA2

61) chain B
residue 182
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1de6
source CSA : CSA2

62) chain B
residue 219
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1de6
source CSA : CSA2

63) chain B
residue 180
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1de6
source CSA : CSA4

64) chain B
residue 182
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1de6
source CSA : CSA4

65) chain B
residue 56
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1de6
source CSA : CSA4

66) chain B
residue 53
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1de6
source CSA : CSA4


Display surface

Download
Links